(data stored in ACNUC29543 zone)

EMBL: CP001044.PE307

CP001044.PE307       Location/Qualifiers
FT   CDS_pept        347505..348611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72576"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL47"
FT                   /protein_id="ACC72576.1"
FT                   /translation="MTKNTVMSADDLFAAMKSDFEGKRRRKFAAGLLVALIDFMKALDT
FT                   PSLKLKGLDEFYAKFPRQIKTAAGLGANTLIVSKPAGGTVSIRPFYGAIENFFRNKEKR
FT                   YDFPSAAPHATQSWPDYVDWIGSLATFDLPTLDSLRDKVVKYVLEKLPSHEVDSSEIAK
FT                   DPPVFEIFLRDFNFRAVGRGEPTGSGFQGAVFAYIRADSPHLQVEVDKTRTGSKRVHRI
FT                   GDIDAWDGSRLVKTCEVKHFKVMTADAIDFTAFAGEAGKRRAGAYLVAEDFESEETRSA
FT                   IEELGVKTMTLEDLKHHVSVWDPLKQQIALQAFEYFITHREQNSSLTSRFRQFCLDKGF
FT                   RYVWSRPVVDDYGNQVSLLVLDESWKAD"
     atgacgaaga atacagtgat gtcagccgac gacctgttcg cggcgatgaa aagcgatttt        60
     gaagggaagc gccgccggaa gtttgccgca gggttgctcg ttgccctcat cgatttcatg       120
     aaagcactgg atactccaag tttgaaattg aaagggctcg acgagtttta cgccaaattt       180
     cctcgccaaa ttaagactgc tgctggcctc ggtgccaaca cattaattgt aagcaagccg       240
     gcaggtggca ccgtcagcat ccgaccgttt tacggtgcaa tcgaaaattt cttccgcaat       300
     aaagagaagc gctatgactt tccaagcgcg gcaccgcatg cgacgcaatc ttggcctgat       360
     tacgttgatt ggataggttc actagcaacg ttcgaccttc caaccttgga ttcattgcga       420
     gacaaggtcg ttaagtatgt gttggagaag ctgccgtcgc atgaagtcga tagctccgaa       480
     atcgcgaaag atccgcctgt ctttgaaatc tttttgcgag acttcaattt ccgagccgtt       540
     ggtagaggtg agcctaccgg gtctgggttc caaggggcag tgttcgccta catccgtgcg       600
     gattcgccac atttgcaagt tgaagtggat aagactcgaa cgggttcgaa gcgagtccat       660
     cgcataggcg acatcgatgc gtgggatggc agccgcctag tcaaaacctg tgaagtgaaa       720
     cacttcaaag tgatgacggc ggacgcgatc gactttacgg cattcgcggg agaggcaggc       780
     aagcggcgag ccggggccta cctcgtcgct gaagacttcg aaagcgagga aacgcgaagc       840
     gccatcgagg aactcggcgt aaagaccatg acgcttgagg acctgaagca ccacgtctcg       900
     gtgtgggacc cactgaaaca acaaatcgcg ctgcaggcct tcgaatactt catcacccat       960
     cgggaacaaa actcatcact aacgagccgc ttccggcaat tttgccttga caaggggttt      1020
     cggtatgtct ggagtcggcc cgtcgtcgac gactacggca atcaggtgag ccttttggtg      1080
     ctcgatgaat cgtggaaggc cgactaa                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page