(data stored in ACNUC29543 zone)

EMBL: CP001044.PE308

CP001044.PE308       Location/Qualifiers
FT   CDS_pept        348742..349866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3423"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   rca:Rcas_1171 DNA methylase N-4/N-6 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3423"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72577"
FT                   /db_xref="GOA:B2JL48"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL48"
FT                   /protein_id="ACC72577.1"
FT                   /translation="MSLAPGVIRDSIIEYLAMVGKDASTEEIVAAVKRSVGAAPTSSVR
FT                   SYLSLNTPTTFERVGRGRYRLRSASLLDHHATRETKILKLGQATLHQGDCFEWLASQKP
FT                   SSVHAVVTDPPYGLVEYTAKETAKLRAGKGGVWRIPPSFDGHQRAPLPRFTVLTDTDRQ
FT                   ALHAFFKRFGTLIGRVAVPGANVVIASNPLLAHIVAEAMGLAGLELRGYIARQVMTMRG
FT                   GDRPKNAHEEFDGVSVMPRSQWEPWVVLRKPLEGRVQDNLRRWGTGGFRRPSKERPFGD
FT                   LIKSHPTPASEKKIAPHPSLKPQAFMRQIVRAVLPLEEGIVLDPFMGAGSTLAAANAVG
FT                   YQSCGVELDEEFFALAAKAVPKLAAIPVRDLDAE"
     atgtcgctgg ctccaggggt aatccgggac tcaatcatcg agtatctcgc gatggtcgga        60
     aaggatgcgt caacagaaga gatcgtggcc gcagtaaagc gctctgtcgg agcggcgccg       120
     acatcatccg tgcgatctta tttgagtttg aatacgccga cgacgttcga gcgcgttggt       180
     agaggtcgtt accggctaag aagcgcttcg ctcctcgacc accacgctac ccgtgaaacc       240
     aaaatattga aactcggaca ggccacgcta catcagggcg attgctttga atggctcgca       300
     agccagaaac cttcttctgt tcatgcggtc gtcaccgacc ccccctacgg cctggttgaa       360
     tacaccgcca aggaaacggc aaagctgcgg gcaggaaaag gcggagtctg gcgcattccg       420
     ccatcttttg acggccatca gcgggcacca ttgcctcgct tcaccgttct gaccgacaca       480
     gatcggcagg cgctgcacgc gtttttcaag cgcttcggca ctttgatcgg tagggtcgca       540
     gtgcccggcg cgaacgtcgt cattgcctcg aatccgctcc tggctcacat cgtggcagaa       600
     gctatgggcc tagctgggtt ggagttacgt ggatatatcg cccgccaagt aatgacgatg       660
     cgtggtggcg atcgtcccaa gaatgcgcat gaagaatttg acggcgtatc ggttatgccg       720
     cgttctcagt gggagccatg ggtagtgctt cgcaagccgc ttgagggccg agtgcaagac       780
     aaccttcgac gttggggaac aggtggtttc cgccgcccct cgaaagagcg tcccttcggt       840
     gatcttatta agtctcatcc gacgcccgcg agcgaaaaga aaattgcgcc acatccttca       900
     ctcaaacccc aggcattcat gcggcagatt gtccgcgcgg tcctgccctt ggaagaaggg       960
     atcgtgttag atcccttcat gggcgccggc tcgacccttg ctgcggccaa tgcggtcgga      1020
     tatcaaagtt gcggtgttga actggacgag gaatttttcg ctttggctgc caaggctgtg      1080
     ccaaagctcg cggccattcc cgtgagggat cttgatgccg agtag                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page