(data stored in ACNUC29543 zone)

EMBL: CP001044.PE309

CP001044.PE309       Location/Qualifiers
FT   CDS_pept        complement(350060..351373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3424"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: bxe:Bxe_A3658
FT                   putative bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3424"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72578"
FT                   /db_xref="GOA:B2JL49"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL49"
FT                   /protein_id="ACC72578.1"
FT                   /translation="MANERINRELIRRLEAERKAKIAAGGTLKVREIYDDLQRGFGVRM
FT                   SVKGSLSFVYRWTRPDGGQQRIVIGDASMTVEEARKALAKFIARTDHKVDDTSVRVTKH
FT                   ERRVADAKNVGMPTVGDYLDGDYRTFWLGSTRSETPEQNIKNIRRDFPDLMDRRLDEVT
FT                   RPAMKKWIEKRLADGCKATGINRVLGSIGGLFSYAVEHEIIAANPCAKLRCKIDPEEDS
FT                   EHGRELTAEEEQRLRVVLDERETRIREEAAARHDSRKVATIPGEFHSFVDHVKPAILLA
FT                   LNTGMRRSELLRARWTAIDWKAQTIRIEAWTSKVKRTRVIPMNVEALSILKAWRRQTRF
FT                   EFIFTNEIGECLREVRDWNKIKREAQIRDFRFMDTRHHTATRMINEGASPYHVQKLLGH
FT                   KDGRMTQRYMRARDVKLAEAVALLDVPRQADADHPVAA"
     atggcgaacg aacgtatcaa ccgcgaactg atccggcgac tcgaagccga gcgaaaggcg        60
     aagatcgcgg cgggcggcac tttgaaggtc cgcgagatct acgatgacct gcagcgcggc       120
     tttggcgtgc gcatgagcgt caagggctcg ctctcgtttg tgtaccgctg gacccgaccc       180
     gatggcggac agcagcggat cgtgattggc gatgcgtcga tgacagtcga agaagcccgc       240
     aaagcactgg cgaagttcat cgcgcgcacc gatcacaagg tcgatgacac gtcggtgcgc       300
     gtcacgaagc acgagcggcg cgtcgccgat gcgaagaacg tcgggatgcc gacagtaggc       360
     gactacctcg atggcgacta tcggaccttt tggctcggca gcacgcgaag cgagacgccc       420
     gaacagaaca tcaaaaatat ccggcgcgat ttccccgacc tcatggacag acggctcgac       480
     gaagtcacac gtcccgcgat gaaaaaatgg atcgagaaac gcctcgcgga cgggtgcaag       540
     gcgactggta tcaatcgcgt actcggctcg attggtggcc tgttctcgta cgctgtggag       600
     cacgaaatca tcgcggccaa tccgtgcgcg aaactgcgct gcaagatcga tcccgaagaa       660
     gacagcgagc acggccgcga actgaccgcc gaagaagaac agcgcctgcg cgtggtactc       720
     gacgagcgcg agacgcgcat ccgtgaagaa gcggcggcgc gtcacgacag ccgcaaggtc       780
     gccacgatac cgggcgagtt ccactcgttc gtcgatcacg tcaagcccgc gatcctgctg       840
     gcgctcaata ccggaatgcg ccggtccgaa ctgctgcgcg cccgctggac cgcgattgac       900
     tggaaagcgc agaccatcag gatcgaggcg tggacatcga aggtcaagcg cacgcgcgtg       960
     attccgatga acgtcgaagc gctttcgatc ctaaaggcgt ggcgccgtca gacgaggttc      1020
     gagttcatct tcacgaacga gatcggcgaa tgtctgcgcg aggtgcgcga ctggaacaag      1080
     atcaagcgcg aggcgcaaat tcgcgacttc cgtttcatgg atacacgtca tcacacagcg      1140
     acgcgcatga tcaacgaagg cgcgtctccg tatcacgtgc agaagttgct cggacacaaa      1200
     gatggccgca tgacgcagcg atacatgcgg gcgcgcgatg tgaaactagc ggaagccgtc      1260
     gcgctcctcg acgtgccgcg ccaggccgat gctgatcacc cggtagcagc ataa            1314
//

If you have problems or comments...

PBIL Back to PBIL home page