(data stored in ACNUC29543 zone)

EMBL: CP001044.PE31

CP001044.PE31        Location/Qualifiers
FT   CDS_pept        27262..27900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3132"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   bxe:Bxe_B2075 amino acid efflux pump, RhtB family, LysE
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3132"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72300"
FT                   /db_xref="GOA:B2JRH3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH3"
FT                   /protein_id="ACC72300.1"
FT                   /translation="MTTLPILSANVLFAYSAYFVGTASPGPSNLAIMSIATADGRKAAF
FT                   SFAAGVVCGSCFWAMLAALGLSAALLAFSGLMAGLKIFGGCYLLWLAFKSGRSAWQPRA
FT                   AQAQTAGGNPSLRRLYTRGLLLHLTNPKAILVWISVVALASPPNGSAPHMLTIVAGCLA
FT                   IGMLVFGSYAALFSTPFARRVYLSVRRWLDGGLAVVFGLAGLKLLTARA"
     atgaccaccc tgccgatcct ttccgccaac gtcctgttcg cctactccgc gtatttcgtc        60
     ggcacggcaa gcccgggacc gagcaatctc gccatcatgt cgatcgccac cgcggacggc       120
     cgcaaagctg cattttcgtt tgccgcgggc gtcgtgtgcg gctcgtgctt ctgggcgatg       180
     ctggcggcgc tcgggctgtc ggcggcactg ctggcgtttt cggggctgat ggccgggttg       240
     aagattttcg gtggatgcta tctgctgtgg ctcgcgttca agtcgggccg ctcggcatgg       300
     cagccgcgtg ccgcacaggc acagacggcg ggcggcaatc cgtcgttgcg tcgtctctat       360
     acgcgcggcc tgctgctgca tctcacgaat ccgaaggcaa ttctcgtgtg gatttccgtc       420
     gtcgcgctcg cgtcgccacc gaatgggagc gcgccgcata tgctgaccat cgtcgccggc       480
     tgtcttgcga tcggcatgct ggtgttcggc agctacgccg ccctcttctc gacgccgttc       540
     gcgcgccgcg tgtatctgtc ggtccgccgc tggctcgatg gcgggctcgc tgtcgtgttc       600
     gggctggcag ggttgaagct gctgactgcg cgcgcctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page