(data stored in ACNUC29543 zone)

EMBL: CP001044.PE312

CP001044.PE312       Location/Qualifiers
FT   CDS_pept        352713..354659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3427"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: bxe:Bxe_B1075 sigma54 specific
FT                   transcriptional regulator with GAF sensor, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3427"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72581"
FT                   /db_xref="GOA:B2JL52"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL52"
FT                   /protein_id="ACC72581.1"
FT                   /translation="MTQRSVTPSVMGRADALAQAHARSREFGLRASEAPDFHPLQPFAL
FT                   RDLVELNRSLYAHALPVMETLHAQIVDTESMVLLTDSNGVILHSLGDSDFVEKASRVAL
FT                   CAGVSWSEAHRGTNAIGTALAEGEPTVVHGGEHFLEANRILTCSCAPIADPYGRTIGAL
FT                   DVSGDPRGFHKHTLALVRMSAQIIENQLFANQFGNAVRVRFHARSEFIGTLFEGLAAFG
FT                   ANGTLLAANRSALFQFGRPLDALLAQPFEALFGTAFPAALQQASRAPGECLTLMLPSGV
FT                   RVLARAEYAARPAFSADARPQHTAAPVPPAPASCKPRAAAITFATLDTGDARMAAVLGR
FT                   VEKVRGRDIPLLVLGKTGTGKEWLARAMHEESPRRDAPFVAVNCASLPDTLIEAELFGY
FT                   EDGAFTGARKRGNVGKIVQADGGTLFLDEIGDMPLAQQVRLMRVLQERSVVPLGGTRAV
FT                   PVDVRVVCATHRNLRAMIEAGTFREDLYYRINGLVVTLPALAERTDLPVLVERILGRLR
FT                   LVEPDSDRMPARVSLEVLDCFARCRWPGNLRQLANVLRTAGIMAEGAAEIGLDHLPDDF
FT                   LHDCEPPRDTPLHALPATDPPLAARPANMEELQATLIEQTLARNNGNISAAARELGLAR
FT                   NTVYRYMRMRTTH"
     gtgacccaac gttccgtcac gccgtccgtc atgggccgcg ccgacgcgct cgcgcaggct        60
     catgcgcgtt cgcgcgaatt cggcttgcgc gcatcggagg cgccagactt tcatccgttg       120
     cagccgttcg ccctgcgcga tctcgtcgaa ctcaaccgct cgttgtatgc gcacgcgctg       180
     cccgtgatgg aaacgctgca cgcgcagatc gtcgatacgg aaagcatggt gctgctcacc       240
     gacagcaacg gcgtgattct gcacagtctc ggcgacagcg atttcgtcga gaaagcgagc       300
     cgcgttgcac tctgcgcagg cgtgtcgtgg tcggaggcgc atcgcggcac gaacgccatc       360
     ggcacggcgc tcgccgaagg cgagccgacc gtcgtgcacg gcggcgagca ttttctcgag       420
     gccaaccgca tcctcacctg ctcgtgcgcg ccgatcgccg atccgtatgg ccgcacgatc       480
     ggcgcgctcg acgtgagcgg cgacccgcga ggcttccaca agcacacgct ggcgctggtg       540
     cgcatgtcgg cacagatcat cgaaaaccag ttgttcgcga accagttcgg caatgccgtg       600
     cgcgtgcgct ttcatgcgcg cagcgagttc atcggcacgc tgttcgaagg gctcgccgca       660
     ttcggcgcca acggcacgct gctcgcggcc aaccgcagcg cgctgttcca gttcggccgg       720
     ccgctcgacg cactgctagc acagccgttc gaggcgctgt tcggcacggc gtttccggct       780
     gcgctgcagc aggcatcgcg cgcaccgggc gaatgcctga cgctgatgct gccaagcggc       840
     gtgcgcgtgc tggcgcgtgc tgaatacgcg gcgcgccccg cgttttccgc cgacgcacgc       900
     ccgcagcaca cagcggcgcc tgtgccgccg gcacccgcgt cgtgcaagcc gcgcgccgcc       960
     gccatcacct tcgcgacgct cgatacgggc gacgcgcgca tggccgccgt actcggccgc      1020
     gtcgagaaag tgcgtggccg cgatattccg ctgctcgtac tcggcaagac gggcaccggc      1080
     aaggaatggc tcgcgcgcgc gatgcacgag gaatcgccgc gacgcgatgc gccgttcgtc      1140
     gccgtcaatt gcgcgtcgtt gccggacacg ctcatcgagg cggaactgtt cggctatgaa      1200
     gacggcgcgt tcacgggcgc gcgcaagcgc ggcaacgtcg gcaagatcgt gcaggccgac      1260
     ggcggcacac tgttcctcga tgaaatcggc gacatgccgc tcgcgcagca ggtgcgtctg      1320
     atgcgcgtgc tgcaggagcg ctccgtggtg ccgctcggcg gcacgcgcgc ggtgcccgtc      1380
     gatgtccgcg tcgtctgcgc gacgcaccgc aacctgcgcg cgatgatcga agcgggcacc      1440
     ttccgcgaag acctctacta ccggatcaac gggctcgtcg tcaccctccc cgcgctggcc      1500
     gagcgcaccg atctgcccgt gctcgtcgaa cggattctcg ggcggctgcg cttggtcgag      1560
     cccgacagcg acagaatgcc agcgcgcgtg tctttggagg tgctcgactg cttcgcgcgc      1620
     tgccgctggc ccggcaatct gcggcaactg gcgaatgtgc tgcgcacggc gggcatcatg      1680
     gccgaaggcg ccgcggaaat cggactggac catctgcccg acgatttcct gcacgactgc      1740
     gagccgccac gcgacacgcc gctgcatgcg ctgcccgcca ccgatcctcc tcttgcagcg      1800
     cgcccggcca acatggaaga actgcaggcg acgttgatcg agcagacgct cgcgcgcaac      1860
     aatggcaata tttcggcggc cgcgcgcgaa ctgggtctcg cccggaacac ggtctaccgc      1920
     tacatgagga tgcgcaccac gcactga                                          1947
//

If you have problems or comments...

PBIL Back to PBIL home page