(data stored in ACNUC29543 zone)

EMBL: CP001044.PE319

CP001044.PE319       Location/Qualifiers
FT   CDS_pept        360333..360467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3435"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0242 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3435"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72588"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL59"
FT                   /protein_id="ACC72588.1"
FT                   /translation="MHVEHAYRQLAFRRLADTPTISQLRVWSPSNRNPCLARFLEMAN"
     gtgcatgtag aacatgcgta tcgacaactc gcgttcaggc ggctggccga tacaccgacg        60
     atctcgcaac tgcgcgtgtg gtcgccgtcg aaccgcaatc cgtgtctggc gcggtttctg       120
     gaaatggcga actga                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page