(data stored in ACNUC29543 zone)

EMBL: CP001044.PE32

CP001044.PE32        Location/Qualifiers
FT   CDS_pept        complement(27908..28852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3735 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3133"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72301"
FT                   /db_xref="GOA:B2JRH4"
FT                   /db_xref="InterPro:IPR004352"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016062"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH4"
FT                   /protein_id="ACC72301.1"
FT                   /translation="MRRVLAAFAAFAAFALPLAGAHGADRAAAVETRAFEASPWMSYYG
FT                   DAAGLGSLARVASRFRVIDVDLDPGTDNFTPAEVAVLKNGGRNIVLSYLNLGSCETWRS
FT                   YWREAPAGFVSCAANTAAHAGMYCGYGQEVWMNLSNAAYRRLIVDYVAPRLVAQGADGF
FT                   YLDNLEIVEHGTATRNGPCDAACAQGGLDLVRELREKYPRLVFVMQNATGRTTREGSTG
FT                   GVAFAALLDGVAHEEVYAPKYDASAEAELAVWQAMTLTPNGHAFWIATLDYVGGCDAST
FT                   RARRVFARSRAKGFVPYASDSSARQGVVCYWGK"
     atgcgacggg tgctcgcggc gttcgccgcg ttcgcggcgt tcgcattgcc gctggcgggc        60
     gcgcatggcg cggatcgagc cgccgccgtc gagactcgcg cgttcgaagc atcgccgtgg       120
     atgtcgtact acggcgacgc ggcggggctc ggcagcctcg cgcgcgtcgc gtcgaggttc       180
     cgcgtaatcg atgtcgacct tgaccccggc acggacaact tcacacccgc cgaagtcgcc       240
     gtgttgaaga acggcggccg caacatcgtg ctgagctacc tgaacctcgg atcatgcgag       300
     acctggcgct cgtactggcg cgaggcgccg gccggcttcg tatcgtgcgc cgcgaatacg       360
     gcggcgcatg cgggcatgta ttgcggctac gggcaggaag tgtggatgaa cctgtcgaac       420
     gccgcttacc ggcggctcat cgtcgattac gtcgcgccgc gcctcgttgc gcaaggcgcg       480
     gacggcttct atctcgacaa ccttgaaatc gtcgagcacg gcacggcgac gcgcaacggt       540
     ccgtgtgacg ccgcgtgcgc gcaaggcggc ctcgatctcg tgcgcgagtt gcgcgagaaa       600
     tatccgcggc tcgtcttcgt gatgcagaac gcgacggggc gcaccacgcg cgaaggctcg       660
     acgggcggtg tcgcgtttgc agcgctgctc gacggcgtgg cgcacgaaga ggtgtacgcg       720
     ccgaaatacg atgcatctgc cgaagcggaa ctggccgtgt ggcaagcgat gacgctcacg       780
     ccgaatggac acgcattctg gatcgcaacg ctcgattatg tcggtggctg cgatgcctcg       840
     acgcgtgcgc ggcgcgtgtt cgcgcgcagc cgggcgaagg gtttcgttcc gtatgcgtcg       900
     gacagcagcg cgcggcaggg cgtcgtgtgt tactggggaa agtga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page