(data stored in ACNUC29543 zone)

EMBL: CP001044.PE320

CP001044.PE320       Location/Qualifiers
FT   CDS_pept        complement(360547..361314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3436"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72589"
FT                   /db_xref="GOA:B2JL60"
FT                   /db_xref="InterPro:IPR012666"
FT                   /db_xref="UniProtKB/TrEMBL:B2JL60"
FT                   /protein_id="ACC72589.1"
FT                   /translation="MVGKLLMRGMLAGIVAGLLTFAFARVAGEPLVDTAISLEHKLHAE
FT                   HDHADAGGHDHDEELVSRGTQAGLGLLTGVVAYGMAFGGLFALSFAYLHGRVGKLSARA
FT                   LSAWLALGAYVAVVLVPTIKYPANPPSVGDPDTIGTRTGLFFLMIVTSLVVAVFSMKVR
FT                   KHLMPRLGVWNASITGGIVFIAIIAAIQIALPTVNEVPEAFPAVVLWKFRVTALGMQAI
FT                   TWAVIGLLFGALAERSERIARESNAAARKSAYL"
     atggttggaa aattgctgat gcgaggcatg ctcgcaggca tcgtcgcggg cttgctcacc        60
     ttcgcgtttg cgcgcgtggc aggcgagccg ctggtggaca cggcgatctc actggaacac       120
     aagttgcacg ccgaacacga tcacgccgat gccggcggcc acgatcacga cgaagaactc       180
     gtcagccgcg gcacgcaggc gggcctcggt ctgctgaccg gcgtcgtcgc gtacggcatg       240
     gcgtttggcg gcctgttcgc gctcagcttc gcgtatctgc acggacgcgt cggcaagttg       300
     agcgcgcgcg cgttgtcggc gtggctcgcg ctcggcgcgt acgttgccgt cgtgctggtg       360
     ccgaccatca agtatccggc gaatccgccc tccgtcggcg atcccgatac gatcggcacg       420
     cgcaccgggc tgttctttct gatgatcgtc acgtcgctcg tcgttgccgt gttctcgatg       480
     aaagtccgca agcatctcat gccgcggctc ggcgtgtgga acgcgtcgat cactggcggc       540
     atcgtgttca tcgcgatcat tgccgcgatc cagatcgcgc tgccgacggt caacgaagtg       600
     ccggaagcgt ttccggccgt cgtgctgtgg aagttccgcg tgacggcgct cggcatgcag       660
     gcgatcacat gggccgtcat cggtctgctg ttcggcgcgc tagccgagcg cagcgaacgc       720
     atcgcgcgtg agtccaacgc ggccgcgcgc aagtcggcct atctttaa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page