(data stored in ACNUC29543 zone)

EMBL: CP001044.PE325

CP001044.PE325       Location/Qualifiers
FT   CDS_pept        363705..363989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3441"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72594"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG1"
FT                   /protein_id="ACC72594.1"
FT                   /translation="MTQGVKTYKGYEIHPLVYPRRTAAGVTHRNSIDSGYDASVRICRV
FT                   GANPAADGRVFRFAYFRPFEGAGKARMACIEHASQVIDGRVDGQSVSDL"
     atgactcaag gcgtcaagac ctacaagggc tacgagattc atccgctggt ttatccgcga        60
     cgcaccgcgg ctggcgtgac acatcgcaat tcgatcgaca gcggctacga cgcgtcggtg       120
     cgcatctgcc gcgtcggggc gaatcccgcc gccgacggcc gcgtgttccg ctttgcgtac       180
     tttcgcccct tcgaaggcgc gggcaaggcg cgcatggctt gcatcgagca tgcatcgcag       240
     gtgatcgacg gccgggtgga cgggcaaagc gtttccgatc tctga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page