(data stored in ACNUC29543 zone)

EMBL: CP001044.PE329

CP001044.PE329       Location/Qualifiers
FT   CDS_pept        366960..367535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3445"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; ANTAR domain
FT                   protein; KEGG: bxe:Bxe_B1048 response regulator receiver
FT                   (CheY) and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3445"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72598"
FT                   /db_xref="GOA:B2JLG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG5"
FT                   /protein_id="ACC72598.1"
FT                   /translation="MLRVLLVTDTDKPIGELRDALARLGYDMLAATASPQALHETVESE
FT                   RPDVVIIDTESPSRDTLEQLAVMNATAPRPVLMFSNDANQQLIRDAVGAGVTAYLVEGL
FT                   ATERLAPILEVALARFAQESQLRERLAHAENELAERKLIDRAKRMLMDSQKMTEHAAYA
FT                   TMRKRAMNQGVKLAEVARQIVAAADLPD"
     atgctgcgtg tcctgctcgt aaccgacacc gacaagccga tcggcgagtt acgcgacgcc        60
     ctcgcgcggc tcggctacga catgcttgcc gcgacggcgt cgccgcaggc gctgcacgaa       120
     acggtggaaa gcgagcggcc cgacgtcgtg atcatcgaca ccgagtcgcc gtcgcgcgac       180
     acgctcgaac agctcgccgt gatgaacgcg accgcgccgc ggcccgtgct gatgttcagc       240
     aatgatgcga accagcagtt gatacgcgat gccgtcggcg cgggcgtgac ggcttatctg       300
     gtcgaagggc tcgcgaccga gcgccttgca ccgatactcg aagtcgcgct cgcccgcttc       360
     gcacaggaat cgcaattgcg cgagcgtctc gcgcacgcgg agaacgagct cgccgagcgc       420
     aagctgatcg accgcgcgaa gcgcatgctg atggactcgc aaaagatgac cgaacacgcc       480
     gcctacgcga cgatgcgcaa gcgcgcgatg aaccagggcg tgaagctcgc cgaagtcgcg       540
     cgccagatcg tcgccgcagc cgacttgcca gactga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page