(data stored in ACNUC29543 zone)

EMBL: CP001044.PE33

CP001044.PE33        Location/Qualifiers
FT   CDS_pept        complement(28957..31275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3134"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: bxe:Bxe_A1494 putative diguanylate
FT                   cyclase/phosphodiesterase(GGDEF & EAL domains) with PAS/PAC
FT                   and GAF sensor(s); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; GAF domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3134"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72302"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH5"
FT                   /protein_id="ACC72302.1"
FT                   /translation="MSRQVTADIATDKPAGRTRHGADLAAEVRASEQSVLRLLTRSTPL
FT                   PELLAEVCRRAETLLGEGARCSILVLDTDGFTVRVGAAPSLPPQYSAAIDGMRLGPCAG
FT                   SCGTAMHDRRLVIVEDIERDPLWADYRHLALPLGLRACWSVPFEDDAGQVLGAFGVYYD
FT                   RRRRPNDGEQALLREIGQSVGLAVHQDLMRKRLAQSEEHHRLVVDHLNEGIVVQSREGV
FT                   VLACNPSARRMLRATGEVIGRDIYKVIRAAFWDDGSPVETAEQPTRRVLRTGRPVVGIT
FT                   LRLELVGGGSIWITENVVPIFKRGETEAGAVLVSFNDISAVQAARAQLQYLATRDSLTG
FT                   LYNRAYLADRMSERLAPHTSAAAHGRGEPRAAARRLAVLFVDLDGFKKVNDIAGHEAGD
FT                   ALLCSVAARLAGCVRSEDTLARVGGDEFVIATGDYTDASFLTSLAQRVLDTIARPFAVG
FT                   GNEYYLGASIGISLFPDDGCDAQTLMRNADSAMYDAKQRGRHNFQFFTAELSQRLKRRF
FT                   GIEQSLRRALAAGELSLAYQPIVEGATGRIVGAEALLRWRNDELGQVSPVEFIPVAEDT
FT                   GMIIDIGRWVLENACRQAVEWRRTITPHLMIAVNLSPRQINGELIGHVAATLEQTGLEP
FT                   SALELEITEGVLMSDSESVMPLLTTLAGMGVRISVDDFGTGYSSLSYLKRFPLHSLKVD
FT                   RSFVAGLPGHRDAVAITHAVVAMAHSLGMSVTAEGVETSEQSAFLRSIGCERQQGYLFG
FT                   RPVVPGDFAREAQRLHAGT"
     atgagtcgtc aagtgactgc agacatcgcg actgacaagc cggccggccg cactcgccac        60
     ggcgcggatc tggccgccga ggtgcgcgcg tcggaacaga gcgtcttgcg cctgcttacg       120
     cgcagcacgc cgctgcccga actgctggca gaggtatgcc gccgtgccga aacgctgctc       180
     ggcgagggcg cacggtgctc gatactcgtg ctcgacaccg acggctttac cgtgcgcgtc       240
     ggcgcggcgc cgtcgctgcc gccacagtac agcgcggcca tcgacggcat gcgcttgggt       300
     ccatgcgccg gctcgtgcgg cacggcgatg cacgaccggc gccttgtgat tgtcgaggac       360
     atcgaacgcg atccgctgtg ggcggactat cggcatctcg cgctgccgct cgggttgcgc       420
     gcctgctggt cggtgccgtt cgaagacgac gcgggccagg tgctcggtgc gttcggcgtc       480
     tactacgaca ggcgccgccg ccccaacgac ggcgaacagg cgctgctgcg cgagatcggc       540
     cagagcgtcg ggctggccgt tcatcaggat ctgatgcgca agcggctcgc gcagagcgag       600
     gagcatcacc ggctggtcgt cgatcatctg aacgaaggca tcgtcgtgca gtcgcgcgaa       660
     ggggtggtgc tcgcctgcaa tccgagcgcg cggcgcatgc tgcgcgcgac gggcgaggtg       720
     attggccggg acatctacaa ggtgattcgc gcggctttct gggacgacgg ttcgcccgtc       780
     gaaacggcgg agcagccgac gcggcgtgtg ttgcgcacgg gccggcccgt ggtcggcatc       840
     acgctgcgtc tcgaactggt gggcggcggc tcgatctgga tcaccgagaa cgtcgtgcct       900
     atcttcaagc ggggagaaac cgaagctggc gccgtgctcg tttcgttcaa tgacatcagc       960
     gcggtgcagg ctgcgcgtgc gcaactgcag tatctcgcga cgcgcgactc gctgacggga      1020
     ctttataacc gcgcctatct cgccgaccgc atgagcgagc ggcttgcgcc gcatacgagc      1080
     gccgccgcgc acggacgcgg agagccgcga gccgctgcgc gcaggctggc ggtgctgttc      1140
     gtcgatctgg acggcttcaa gaaggtcaac gacatcgccg gccacgaagc gggcgatgcg      1200
     ctgttgtgca gcgtcgccgc gcggctcgcc ggctgcgtgc gcagcgagga cacgctcgcc      1260
     cgggtgggcg gcgacgagtt cgtgatcgcg acgggcgatt acaccgacgc gtcgttcctg      1320
     acttcgctcg cgcaacgggt gctcgacacg atcgcgcggc cgttcgcggt cggcggcaac      1380
     gagtattacc tcggtgcgtc gatcggcatc agtctgtttc ccgacgacgg atgcgacgcg      1440
     cagacactga tgcgcaacgc cgactccgcg atgtacgacg cgaagcagcg cggccgccac      1500
     aacttccagt tcttcacggc ggaattgagc cagcgcctga agcggcgctt cggcatcgag      1560
     cagtcgttgc gccgcgcgct cgccgccggc gagctgagcc tcgcgtacca gcccatcgtc      1620
     gagggcgcga cggggcgcat cgtgggcgcc gaagcgctgc tgcggtggcg caacgacgag      1680
     ctgggccagg tgtcgcccgt cgaattcatt cccgtcgcgg aggacacggg catgatcatc      1740
     gatatcggcc gttgggtgct ggagaacgca tgccgtcagg ccgtcgaatg gcgcaggacg      1800
     atcacgccgc atctgatgat cgcggtgaat ctctcgccgc gccagatcaa cggcgaactg      1860
     atcggccatg tcgcggcaac tctggaacag acggggctgg agccgtcggc gctcgaactc      1920
     gaaatcacgg aaggcgtgct gatgagcgac agcgaatccg tcatgccgct tctgacgacg      1980
     ctcgccggca tgggcgtgcg catttccgtc gacgatttcg gcaccggcta ttcgtcgctg      2040
     tcgtatctga agcgctttcc gctgcacagc ctgaaggtcg accggtcgtt cgtcgcgggc      2100
     ttgcccgggc atcgcgatgc tgtggcgatc acgcatgccg tcgtcgcgat ggcgcactcg      2160
     ctcggcatga gcgtgacggc cgaaggcgtc gagacgagcg agcagtcggc gtttctgcgc      2220
     tcgatcggat gcgaacggca acagggctat ctgttcggac ggcccgtcgt gccgggcgac      2280
     ttcgcgcgcg aagcgcaacg gctgcatgcg ggaacctga                             2319
//

If you have problems or comments...

PBIL Back to PBIL home page