(data stored in ACNUC29543 zone)

EMBL: CP001044.PE330

CP001044.PE330       Location/Qualifiers
FT   CDS_pept        367546..368688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3446"
FT                   /product="ABC nitrate transporter, periplasmic ligand
FT                   binding protein"
FT                   /note="KEGG: bxe:Bxe_B1047 ABC nitrate transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3446"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72599"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLG6"
FT                   /protein_id="ACC72599.1"
FT                   /translation="MNSTANTALSADSGKLEKSHLRLGFVALSDAAPLVAAKLLEFGHA
FT                   HGLTIELLKQPSWAAIRDKLLSGDLDAAHSLYGLVYGVQLGLGGPQTDMAVLMVLNRNG
FT                   QAITVSNRLAAALDEHKTLPAALATLGRKPVFAQTFPTGTHAMWLYYWLASQGVDPLRD
FT                   IDSVVIPPPQMVDALARDRLDGLCVGEPWNAVAQERGVGRTIAYTSEVWPDHPEKVLAS
FT                   RRDFVTRYPNTARALVQTMLEACRWLDDDEHRVEIARRLAADEFLGVPAASIASRLVSA
FT                   GCDETRRPVAFFADGAVNYPHPAEGVWFFAQYARWGMVHSRGDFARIANEVNQVQLYRQ
FT                   AAINVGVAVRDDAPSVQLIDGRRWDGNFDRAYLQGFSIKA"
     atgaactcga ccgctaatac cgctctttcc gccgactcgg gcaagctcga gaaatctcac        60
     ttgcgcctcg gcttcgtcgc gctcagcgat gccgcaccgc tcgtcgccgc aaagctgctc       120
     gagttcggcc acgcgcacgg gctgacgatc gaactgttga agcagccttc atgggcagcg       180
     atacgcgaca agctgttatc cggcgacctc gacgccgcgc attctctgta cggccttgtc       240
     tatggcgtgc agctcggcct cggtggaccg caaacggaca tggccgtgct gatggtgctg       300
     aaccgcaatg gccaggcgat cacagtatcg aaccgtcttg ccgccgcgct cgacgagcat       360
     aagacgctgc ctgcggcgct cgcgacgctc ggccgcaagc ccgtcttcgc gcagaccttt       420
     ccgacgggca cgcacgcaat gtggctgtat tactggcttg catcgcaggg cgtggatccg       480
     ttgcgcgata tcgacagcgt ggtgattccg ccgccgcaga tggtggatgc gctcgcgcgg       540
     gaccggctcg acggcttgtg tgtcggcgaa ccgtggaacg ccgttgctca ggaacgcggt       600
     gtcggcagga cgattgcgta cacgagcgag gtgtggcccg atcatcccga gaaagtgctc       660
     gcgagccggc gcgatttcgt cacgcggtat ccgaacacgg cgcgagcgct cgtgcagacg       720
     atgctcgaag cgtgtcgctg gctcgatgac gacgagcatc gggtggagat tgctcgcagg       780
     ctcgctgctg atgagtttct tggtgtgccg gctgcttcta ttgcttcacg gctggtttct       840
     gcaggatgcg atgagacccg acggcctgtt gcgttttttg ctgatggggc tgtcaattat       900
     ccgcatcctg cggaaggggt atggttcttt gctcaatacg cgagatgggg gatggtgcat       960
     tcgcgtggtg actttgctcg tattgctaat gaagtcaatc aggttcagtt gtatcggcag      1020
     gccgccatta acgttggcgt ggctgttcgt gacgatgcgc cttcggtgca gttgatcgat      1080
     gggcgtcgtt gggacggcaa tttcgatcgt gcatatttgc aggggttttc tatcaaggcc      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page