(data stored in ACNUC29543 zone)

EMBL: CP001044.PE34

CP001044.PE34        Location/Qualifiers
FT   CDS_pept        complement(31367..32200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3135"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72303"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH6"
FT                   /protein_id="ACC72303.1"
FT                   /translation="MCRWLAYTGNPIQLEAVLFRAKHSLIDQSLHSRLGQTTTNGDGFG
FT                   VGWYGHPTDIPFRYRCAHPAWSDRNLRDAARAVRAPLFVAHIRAATDTPSQETNCHPFR
FT                   YGRWLFMHNGLIRDYPKVRRDLMLGIDPDLFASIEGSTDSEVMFYLALTFGLEFDPVLA
FT                   LERMAGFIEETGRRHGIEAPLNMTVCATDGEQIVSARYSSERQSRSLYHSTSIRHLMEL
FT                   YPDDPRLAAVGEDAFLVLSEPLVDLEGWWEEIPESTAIVARGGAIESQTFDPHRT"
     atgtgccgct ggctggctta cacagggaac ccgattcagc tcgaagccgt gctgttcagg        60
     gcgaagcact cgttgatcga ccagagtctg cattcgcggc tcggacaaac caccaccaac       120
     ggcgacggct tcggcgtcgg ctggtacggc catccgaccg acatcccatt ccgctaccgc       180
     tgcgcgcatc ccgcgtggag cgaccggaat ctgcgcgacg ccgcgcgtgc cgtgcgcgca       240
     ccgctgttcg tcgcgcatat tcgcgcggcg acagatacgc cgtcgcagga aaccaactgt       300
     catccgtttc gctacggccg ctggctgttc atgcacaacg ggctcatacg cgactatccg       360
     aaagtgcggc gcgacctgat gctcggcatc gacccggacc tgtttgcatc gatcgaaggc       420
     tcgaccgatt ccgaggtcat gttctacctc gcgctgacgt tcgggctgga attcgatcct       480
     gtgctggcgc tcgaacggat ggccggtttc atcgaggaaa cggggcgtcg gcatggcatc       540
     gaggcgccgc tgaacatgac cgtctgcgcg acggacggcg aacagatcgt gtcggcgcgc       600
     tattccagcg aacggcagtc gcgctcgctc tatcacagta cgtcgatccg ccatctgatg       660
     gagctgtacc ccgacgatcc gcgcctcgcc gcggtcggcg aagacgcgtt tctcgtgttg       720
     tcggagccgc tagtcgatct ggaaggatgg tgggaggaaa taccggagtc gacggcgatc       780
     gtcgcgcggg gcggcgcgat cgagtcgcag actttcgacc cgcatcgaac atag             834
//

If you have problems or comments...

PBIL Back to PBIL home page