(data stored in ACNUC29543 zone)

EMBL: CP001044.PE340

CP001044.PE340       Location/Qualifiers
FT   CDS_pept        complement(380559..381542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3456"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72609"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH6"
FT                   /protein_id="ACC72609.1"
FT                   /translation="MPPDSPMNILSRLHMPLCVLRLACTGALRCARLGARCVVMSRVPV
FT                   AALQPIAACAALLRALFDANGRALASERADFCREVMKVASPGRVRLLAARTRESLIDQR
FT                   LHFGRQRRFDEAWPDLQRIAGLLAQAIGQIRRDAPGSPVIVSPFHYVSQYANIYVIDDL
FT                   RVKLGLARIGVVSGMPRDLYGSDGAMIPDIDVLYTYDQNNRSGLGLQVARSLRRHGVVV
FT                   VFADVPPYTLHRYPMETVGVSIFGSAARIHNGVFRMGGPLGAVLLPFYLCFERGRFGGT
FT                   VLEPIRLADADAPQRVAQQIEQALRGNFESSLVTGHPSLYAFAAAK"
     atgccccccg atagtccaat gaatatattg tcgcggcttc acatgccctt gtgcgtgctg        60
     cgcctcgcat gcactggcgc gctgcggtgt gcgcgcctcg gtgcccgttg cgtggtgatg       120
     tcccgcgttc ccgtcgccgc cctccagccg attgccgcct gcgctgcgct attacgggcg       180
     ctattcgacg cgaacgggcg cgcgctcgcg agcgagcgtg ccgatttctg ccgcgaggtg       240
     atgaaagtgg cgagccccgg acgtgtgcgc ctgctcgctg ctcgcacgcg ggaatcgctg       300
     atcgaccagc gcctgcattt cggtcgccag cgccggttcg acgaggcatg gccggatctt       360
     caacggatcg ccggcttgct cgcgcaggca atcgggcaaa tcaggcgcga tgcgcctgga       420
     tctcccgtca tcgtgtcgcc gtttcactac gtatcgcagt acgcgaacat ctatgtgatc       480
     gacgacctgc gggtgaaact cggccttgcg cgtatcggtg tcgtgtccgg catgccgcgc       540
     gacctgtacg gtagcgatgg cgcgatgatc cccgacatcg acgtgcttta tacctacgac       600
     cagaacaatc gcagcggcct gggtctgcaa gtggcgcgct cgctcaggcg gcacggcgtc       660
     gtcgtcgtgt tcgccgatgt gccgccctac acgctgcatc gctacccgat ggaaacggtc       720
     ggcgtgtcga tcttcggcag tgcggcgcgc attcacaatg gcgtgtttcg catgggtggg       780
     ccgctcggcg cggtcctgct gccgttctac ctgtgtttcg agcgcggcag atttggtgga       840
     acggtgctgg agccgatccg gctcgccgat gcagatgcgc cgcaacgtgt cgcccagcag       900
     atcgaacagg cgctcagggg caatttcgaa tcctccctcg ttaccggtca tccgtcgctg       960
     tatgcattcg cggccgcgaa gtaa                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page