(data stored in ACNUC29543 zone)

EMBL: CP001044.PE342

CP001044.PE342       Location/Qualifiers
FT   CDS_pept        complement(382205..382927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3458"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72611"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH8"
FT                   /protein_id="ACC72611.1"
FT                   /translation="MAVRSKVSLCFAVMCLLCDLVDAFGGATFNSSSANAMDFDGAQTS
FT                   RLPAVNAGRTTRHAHSVVSRSRTRRTRCEVARSACRPLASHCRHKSMASVGHVRPRCSV
FT                   IHRRRRERLYAHRNPPAPGQLVTRASEATLVPRCTNGCDLAAGEVLSRDVMRPVESERV
FT                   AQAPRAPDFGGWFGSERPLTVSVRESASTVEQTIAVNVATADQTDGAAKLMLLSAALPA
FT                   TPPLSEWNASSPVAATSR"
     atggcagtac ggagtaaagt ttcgttgtgc tttgcggtga tgtgtctctt atgcgacttg        60
     gtggacgcat tcggaggtgc gacgttcaac tcttccagcg cgaatgcgat ggactttgac       120
     ggtgcgcaga cgtccaggct tccggccgtc aacgcgggcc gtacgacacg gcacgctcat       180
     tccgtcgtgt cgcgttcgcg cacacggcgg acgcgttgtg aagtcgcgcg atccgcatgc       240
     aggccgcttg cgtcgcattg ccggcacaag tcgatggcca gcgtcggcca tgttcgtccg       300
     cgatgttcag tgatccaccg acggcggcga gaacggttgt atgcgcatcg aaatccaccg       360
     gcgcctggcc aacttgtcac gcgcgcgagc gaggcgacgc tggtgccgcg ttgcacgaac       420
     ggttgcgacc ttgcagccgg tgaggtgctc tcgcgtgacg tcatgcggcc tgtcgaaagc       480
     gaacgggttg cgcaggcgcc gcgggcgccg gacttcggtg gctggtttgg cagcgaacgt       540
     cctttgacgg tcagtgtgcg ggaaagcgca tccaccgtcg agcagactat tgcagtgaat       600
     gtcgcgacag ccgaccagac cgacggcgca gcgaagctga tgttgctgag cgccgcgctg       660
     cccgcgacgc ccccgttatc ggagtggaat gcatcatcgc ccgtcgccgc gacgtcgcga       720
     taa                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page