(data stored in ACNUC29543 zone)

EMBL: CP001044.PE343

CP001044.PE343       Location/Qualifiers
FT   CDS_pept        383200..383859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3459"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: bma:BMA1034 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3459"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72612"
FT                   /db_xref="GOA:B2JLH9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLH9"
FT                   /protein_id="ACC72612.1"
FT                   /translation="MNPSRAFRIVIADDHPVIRHAVIHALNGLPGFTVDAAVKSGAELL
FT                   GVLSQGKWDLIITDFTMDTGKSETDGLSLIGQLCRQHPDVPVVVFTMLNNDDMLARLSR
FT                   SGVAGVVDKCEGVEEFRSAALEVMHHRRPYFSAKIRMRLQHLNFGNGRRGGEPALTKKE
FT                   LEVIRLFASGASLTDIARHLNRSLSTIATQKSAAMKKLYLQTNADLVKYAQENGLT"
     atgaacccta gccgcgcctt caggattgtc atcgccgacg accacccagt catccggcac        60
     gctgtcatcc atgcattgaa cggcctcccc ggcttcacgg tcgacgccgc cgtgaagtcc       120
     ggcgccgaac tgctcggcgt gctgtctcaa ggcaaatggg acctcatcat caccgacttc       180
     acgatggaca ccggcaagag cgagactgac ggcctcagcc tgatcggtca gttgtgcaga       240
     cagcatcctg acgttcctgt cgtcgtgttc acgatgctta acaatgacga catgcttgcc       300
     cgcctgtcgc gctcaggggt cgcgggcgtc gtggacaaat gcgaaggcgt cgaggaattc       360
     cgctcggccg cgcttgaagt catgcatcac cggcgacctt atttttccgc aaaaatacgc       420
     atgcgtctgc agcatctgaa cttcggcaac ggccgcagag gaggcgagcc cgctttgacg       480
     aagaaagaac tggaggtgat ccggctgttc gcgtccggcg cgtcgctcac cgacattgcc       540
     cgtcacctga accgatcgct ttcgaccatc gcgacgcaaa aaagcgcggc aatgaagaag       600
     ctctatctgc aaaccaacgc cgatctcgtc aagtatgcgc aggaaaatgg cttgacgtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page