(data stored in ACNUC29543 zone)

EMBL: CP001044.PE347

CP001044.PE347       Location/Qualifiers
FT   CDS_pept        complement(387073..388623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3463"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B1035 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3463"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72616"
FT                   /db_xref="GOA:B2JLI3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI3"
FT                   /protein_id="ACC72616.1"
FT                   /translation="MKEETVQQQRNTQDVPRLELRHASKTFGRVRALSDGELVLWPGEV
FT                   HALLGENGAGKSTLVKILAGVHQPDTGLLRVDGIERRFATPAEARDAGLAVIYQEPTLF
FT                   FDLSIAENIFMGRQPVDRFGRIQHDAMRREVDGLLASLGVDLRADRLVRGLSIADQQVI
FT                   EIAKALSLNANVLIMDEPTAALSLPEVERLFTIVRKLRERDVAILFITHRLDEVFALTQ
FT                   HVTIMRDGAKVFDAPTAEMTTESVVAKMVGRDLETFYPKADVKPGDVRLAVRKLTRTGV
FT                   FKDISFEVRAGEIVALAGLVGAGRSEVARAIFGIDPIDSGEVRVAGKLLPTGNPAAAVR
FT                   AGLALVPEDRRQQGLALELSIARNASMTVLGRLVRHGLISSRSETQLATRWGTRLRLKA
FT                   SDPSAPVGTLSGGNQQKVVLGKWLATGPKVLIIDEPTRGIDVGAKAEVYGALSELVQEG
FT                   MAVLMISSELPEVLGMADRVLVMHEGRISAEIARADASEERIMSAALGQSAALLGRAA"
     atgaaggagg agacggtgca gcaacagcga aacactcagg acgtgccgag gctcgaactg        60
     cggcacgcaa gcaagacgtt cgggcgcgtg cgcgcgctgt cggatggcga actcgtgcta       120
     tggcccggcg aagtgcacgc gctgctcggc gagaacggcg cgggcaaatc gacgcttgtc       180
     aagatactcg ccggcgtgca tcaaccggat acgggcttgc ttcgcgtcga tggcatcgag       240
     cgccgcttcg cgacgcccgc cgaagcgcgc gatgcgggac tcgcggtgat ctatcaggaa       300
     ccgacgctgt tcttcgatct ctcgattgcc gagaacatct tcatgggacg gcagcccgtc       360
     gaccgctttg gccgcatcca gcacgatgcg atgcgtcgcg aagtcgacgg tctgctcgcg       420
     tcgctcggcg tcgatctgcg tgcggaccgc ctcgtgcggg ggctgtcgat cgccgatcag       480
     caagtgatcg agatcgcgaa agcgctgtcg ctgaacgcga atgtactgat catggacgag       540
     ccgacggcgg cgctgtcgct gcccgaagtg gagcggctgt tcacaatcgt gcgcaagctg       600
     cgcgagcgcg acgtggcgat cctgttcatc acccaccggc tcgacgaggt gttcgcgttg       660
     acgcagcacg tcacgatcat gcgcgacggc gcgaaggtgt tcgatgcgcc gaccgccgaa       720
     atgacgacgg agtccgtggt cgcgaagatg gtcggacgcg atctggaaac gttctatccg       780
     aaagcggacg tgaagcccgg cgacgtgcgt ttggcggtgc gcaaactgac gcgcacgggc       840
     gtgttcaagg acatctcgtt cgaggtgcga gcgggcgaaa tcgtcgcgct cgcgggactg       900
     gtcggcgcgg gccgcagcga agtggcgcgt gcgatcttcg gcatcgatcc catcgattca       960
     ggtgaagtgc gcgtcgcggg caagctgctc ccgacgggca atcccgctgc cgctgtgcgc      1020
     gcgggcctcg cgctcgtacc ggaagaccgc cgccagcaag ggctcgcgct cgaactgagc      1080
     atcgcgcgca acgcgtcgat gacggtgctc ggacggctcg tgcgccatgg cctgatttct      1140
     tcgcgcagcg aaacacagct tgcaacgcgc tggggcacgc ggctgcgcct gaaggcaagc      1200
     gacccgtccg cgcccgtcgg cacgctctcg ggaggcaacc agcagaaagt ggtgctcggc      1260
     aagtggcttg cgacaggccc gaaggtgctc atcatcgacg agccgacgcg cggcatcgac      1320
     gtcggcgcga aggccgaggt gtatggcgcg ctatccgaac tcgtgcagga aggcatggcg      1380
     gtgctgatga tttcgagcga actgcctgaa gtgctcggca tggccgaccg cgtgctggtg      1440
     atgcacgaag gccgcatcag tgccgagatc gcgcgcgccg atgctagcga ggaacggatc      1500
     atgagcgcgg cactcggcca atcggcggca ttactggggc gcgcagcatg a               1551
//

If you have problems or comments...

PBIL Back to PBIL home page