(data stored in ACNUC29543 zone)

EMBL: CP001044.PE35

CP001044.PE35        Location/Qualifiers
FT   CDS_pept        complement(32261..32932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3136"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: bte:BTH_II1391 putative multiple antibiotic
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3136"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72304"
FT                   /db_xref="GOA:B2JRH7"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRH7"
FT                   /protein_id="ACC72304.1"
FT                   /translation="MIASLVSEILFGFTGLISIINPIAIAFVFLDRTDSLTDAERAALA
FT                   RRVAINAFFVLLVVFFVGTPILHFFGISMEALRIGGGLAVAVSAWNMLNAPERQPNEAA
FT                   VKPVDPDNAMSKAFFPLTVPLTTGPGTMATAIALNANRSHKLSEFLMSSIASVTISVLV
FT                   MFAIWFTYNHAATFARLLGKEGTKVALRVSAFLLLCIGVQIILTGLAEFLAPIAAGRLN
FT                   N"
     atgattgcga gccttgtttc ggagatcctg tttggcttca cggggttgat cagcatcatc        60
     aatccgatcg cgattgcctt tgtgtttctc gaccgcacgg actcgctgac ggacgccgaa       120
     cgcgccgcgc tcgcccggcg cgtcgccatc aatgcgttct tcgtgctgct ggtcgtattc       180
     tttgtgggca cgccgatcct gcatttcttc ggcatctcga tggaggcatt gcgcatcggc       240
     ggcggactcg ctgtagccgt gagcgcatgg aacatgctga acgcgcccga acggcagccg       300
     aacgaagccg ccgtgaaacc tgtcgatccc gacaatgcca tgtcgaaggc attctttccg       360
     ttgacggtgc cgctcacgac aggccccggc acgatggcga cggcgatcgc gctgaacgcc       420
     aaccgcagtc acaagctgtc ggagttcctg atgtcgtcga ttgcgtccgt gaccatttcg       480
     gttcttgtca tgttcgcaat ctggtttacg tataaccatg ctgcgacgtt cgcgcgcctg       540
     ctcggcaagg aagggacgaa ggtggcgttg cgggtgtccg cattcctgct gttgtgcatc       600
     ggcgtgcaga ttatcctgac gggtctggcc gagttccttg cgccgattgc ggccgggcgc       660
     ctaaacaact ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page