(data stored in ACNUC29543 zone)

EMBL: CP001044.PE351

CP001044.PE351       Location/Qualifiers
FT   CDS_pept        complement(391324..392106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3467"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bxe:Bxe_B1031 putative short-chain
FT                   alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3467"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72620"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLI7"
FT                   /protein_id="ACC72620.1"
FT                   /translation="MLLKDKSVIVTGGSRGIGRAIAVACAREGADVAVNYWGDNDASYD
FT                   RRSAVDEVVGEIEALGRRVIAVEGNVAVKATGTELVRRTVEAFGKVDVLASNAGICPFH
FT                   AFLDMPVEVLETTVAVNLNGAFFVTQAAAQQMKAQGTGGAIVATSSISALVGGGMQTHY
FT                   TPTKAGVHSLMQSCAVALGPFGIRCNSVMPGTIATDLNAEDLADEGKKAYFEKRIPLGR
FT                   LGRPDDVAECVVFLASDRARYVTGAALLVDGGLFVNLQ"
     gtgctgctga aagacaagtc ggtgatcgtg acgggcggct cgcgcggcat tggccgcgcg        60
     atcgcggtgg catgcgcacg cgaaggcgcg gatgtcgccg tcaattactg gggcgataac       120
     gacgcatcgt atgaccgcag atcggcggtc gacgaggtgg tcggcgagat cgaggcgctg       180
     ggacggcgcg tgatcgccgt cgaggggaat gtcgctgtga aggcaacagg taccgagctc       240
     gtgcggcgca cggtggaggc atttggcaag gtcgatgtgt tggccagcaa tgcgggtatt       300
     tgcccgtttc atgcgtttct cgatatgcct gtcgaggtac tcgaaacgac tgttgccgtc       360
     aatctgaatg gcgcgttctt tgtcacgcag gccgctgcgc agcagatgaa agcgcagggc       420
     acgggtgggg cgatcgttgc gacgagctcg attagcgcgt tggtcggcgg cggcatgcag       480
     acgcattaca cgccgaccaa ggccggggtg cattctttaa tgcagtcatg tgctgttgcg       540
     cttgggccct tcgggatccg gtgtaactct gtcatgcctg gcacgattgc caccgatctc       600
     aatgccgagg accttgccga tgaaggcaag aaggcttact tcgagaagcg cattccactt       660
     gggcggttgg ggcggccgga tgacgtcgcc gagtgtgtgg tgtttttggc ctccgaccgg       720
     gccaggtatg tcactggcgc cgctttgctc gttgatggcg ggttgtttgt gaatttgcag       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page