(data stored in ACNUC29543 zone)

EMBL: CP001044.PE352

CP001044.PE352       Location/Qualifiers
FT   CDS_pept        complement(392121..393299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3468"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bxe:Bxe_B1030 putative mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3468"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72621"
FT                   /db_xref="GOA:B2JLI8"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR023444"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JLI8"
FT                   /protein_id="ACC72621.1"
FT                   /translation="MAMPSIRHVRAFVVRGGGADYHDQADGHWIDDHISTPMARYPEYR
FT                   QSRQSFGINVLGTLVVEIEASDGTVGFAVTTGGEIGAFIVEKHLARFLEGQLVTDIEKM
FT                   WDQMYFSTLYYGRKGVVLNTISGVDLALWDLLAKVRKEPVYQLLGGPVRDELQFYATGA
FT                   RPDLAKEMGFIGGKLPLQHSPAEGEEGLRKNIDKLAEMRGRVGGDFWLMYDCWMSLDVT
FT                   YATKLAKAAHEHGLKWIEEALPPDDYWGYAELRRNVPRGMMVSTGEHEATRWGFRMLLE
FT                   MGCCDLIQPDVGWCGGITELVKISALADAHNVLVVPHGSSVYSYHFVVTRHNSPFAEFL
FT                   MMAPKADQVVPMFTPLLLDEPVPVNGRMRVPDTPGFGVRLNPECKLERPYQH"
     atggcgatgc cctctatccg gcacgtgcgt gccttcgtcg tccgcggcgg cggcgcggac        60
     taccacgatc aggccgacgg acactggatc gatgatcaca tctcgacgcc gatggcgcgt       120
     taccccgaat accggcaaag ccggcagtcg ttcggcatca acgtgctggg tacgctggtc       180
     gtcgaaatcg aggcgagcga cggcacggtc ggcttcgcgg tgaccacggg cggcgagatc       240
     ggcgcgttca tcgtcgagaa gcatctggcg cgcttcctcg aagggcagct cgtgacggac       300
     atcgagaaga tgtgggatca gatgtacttc tcgacgctct attacgggcg caagggcgtc       360
     gtgctcaaca cgatatcggg cgtcgatctt gcgttgtggg atctactcgc gaaagtgcgc       420
     aaggagcccg tgtatcaact attgggcggt ccggtgcgcg acgaactgca gttctacgcg       480
     acgggtgcgc ggcccgatct ggcgaaggag atgggtttta tcggcggcaa gctgccgctg       540
     cagcacagtc ctgccgaagg cgaagagggc ttgcgcaaga acatcgacaa actggctgag       600
     atgcgcggac gagtcggcgg cgatttctgg ctgatgtacg actgctggat gagtctcgac       660
     gtgacgtatg cgacgaagct tgcgaaggcg gcgcacgagc acgggctgaa gtggatcgaa       720
     gaagccttgc cgcccgacga ttactggggt tacgccgaac tgcgccgcaa cgtgccgcgc       780
     ggcatgatgg tgtcgacggg cgagcacgag gcgacgcgct ggggtttccg gatgctgctc       840
     gagatgggct gctgcgatct gatccagccg gacgtgggct ggtgcggagg catcacggaa       900
     ctggtcaaga tttccgcgct cgccgatgcg cataacgtgc tggtcgtgcc gcacgggtcg       960
     tcggtgtaca gctatcactt cgttgtcacg cgccacaact cgccgttcgc cgagttcctg      1020
     atgatggcgc cgaaggccga ccaggttgtg ccgatgttta cgccgctgct gctcgacgag      1080
     cccgtgcccg ttaacggccg catgagggtg cccgacacgc cgggtttcgg cgtgcggctg      1140
     aatcccgagt gcaagctcga gcgcccttat cagcattga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page