(data stored in ACNUC29543 zone)

EMBL: CP001044.PE355

CP001044.PE355       Location/Qualifiers
FT   CDS_pept        396300..397019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3471"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bxe:Bxe_B1014 NADPH-dependent FMN reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72624"
FT                   /db_xref="GOA:B2JLJ1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ1"
FT                   /protein_id="ACC72624.1"
FT                   /translation="MVRTCIRPAATAARSLKLTRFDQNRRPLVIGIGGTTRTASSTERA
FT                   LGFALGGAEQAGARTRLFGGAFLHSLPHYAPETAQRTDEQRELIEAVRHADALVIATPG
FT                   YHGGVSGLVKNALDTLEELRADERPYLDGRAVGCIVTAYGWQAAGSVLTSLRSIVHALR
FT                   GWPTPFGAGINTLETRFETADTCSDPKVVDQLSTVGQQAAQFALAFRSHHTGGVAAHAA
FT                   TDDAVDARDSRVLALAN"
     atggttcgaa cgtgcatccg gccggccgcc actgcagcaa ggagcttgaa gttgacccgt        60
     ttcgaccaga accgccgccc tctcgtgatc ggcatcggcg gcaccacgcg caccgcgtcg       120
     tccactgaac gcgcgctcgg cttcgcgctg ggcggcgccg aacaggcggg cgcacgcacg       180
     cggcttttcg gcggcgcgtt cctgcacagc ctgccgcact acgcaccaga aaccgcacag       240
     cgcaccgacg aacaacgcga actgatcgag gccgtgcgcc acgcggatgc gctggtcatc       300
     gcgacacccg gttatcacgg cggcgtgtcg ggcctcgtga agaacgcgct cgatacgctc       360
     gaagaactgc gcgccgacga acgtccctat ctcgacggcc gcgcggtcgg ctgcatcgtc       420
     actgcgtatg gatggcaggc agcaggttcc gtgctgacgt cgctgcgctc gatcgtgcac       480
     gcgttgcgtg gctggccgac gccgttcggc gcgggcatca acacgctcga aacgcgcttc       540
     gaaacggccg atacgtgctc ggatccgaaa gtggtcgatc agttgtcgac ggtcgggcaa       600
     caggccgcgc aattcgctct cgcgtttcgc tcgcatcata cgggtggcgt cgctgcgcac       660
     gctgcaacgg atgacgccgt cgatgcgcgc gactcgagag tgctcgcgct cgccaactga       720
//

If you have problems or comments...

PBIL Back to PBIL home page