(data stored in ACNUC29543 zone)

EMBL: CP001044.PE356

CP001044.PE356       Location/Qualifiers
FT   CDS_pept        397353..397634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3472"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72625"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ2"
FT                   /protein_id="ACC72625.1"
FT                   /translation="MKNPNNFRTRSEHPKPEKAVRGSRHLRYKGYEVAPAAQRLPNGLF
FT                   AANLTIEKTTPASGAHAYSFDALDYFFDEEHALAYAYRWGRLWIDSHQ"
     atgaaaaatc caaacaactt ccggacgagg tccgaacacc cgaagccaga gaaggctgtg        60
     cgcggcagcc ggcatctgcg ctacaaaggc tacgaagtcg cgcctgccgc gcagcgcctg       120
     cccaacgggc tgttcgcggc aaatctcacg atcgaaaaaa cgacgcccgc cagcggcgcc       180
     catgcgtact cgttcgacgc gctcgactac ttcttcgacg aagaacacgc gctcgcctac       240
     gcgtaccgct gggggcgtct atggatcgac agccatcaat aa                          282
//

If you have problems or comments...

PBIL Back to PBIL home page