(data stored in ACNUC29543 zone)

EMBL: CP001044.PE362

CP001044.PE362       Location/Qualifiers
FT   CDS_pept        complement(404887..407217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3482"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: Organic solvent tolerance protein; KEGG:
FT                   bxe:Bxe_A4024 putative organic solvent tolerance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72631"
FT                   /db_xref="GOA:B2JLJ8"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLJ8"
FT                   /protein_id="ACC72631.1"
FT                   /translation="MIFRREVQGLAIRPIAALVLCLLAPVAVHAQLVGDAASAERLSDA
FT                   WSLRFAPQLTETPSVPGVKAATIGLGDAVTGTVDSDVSLKGAAELRRYGFVVKGDALHY
FT                   DVDGDMADAYGHVSIVSKGDVFTGPFGQLHVDASEGIIAQPRYRFYLNGGWGSGRRAEL
FT                   LDNERSKIEDGTYSTCDCDGNPAWYIRASQFAMDRGADEGVAHNGVLYFQNIPLLASPW
FT                   LSFPLDGARRSGLLSPTWSMSSKNGVDITVPYYFNVAPNYDLTIAPRYMSKRGEMLSAD
FT                   YRYLTEASSGSLSIAYLPNDITTHERRYSIDLNHIWRLGSGFAAYVNYNRVSDANVSTD
FT                   LGSGSAFPTSSTTLYQQEAGLTYNNGPWSVLAREQHWQSFSSDTTYNREPQVNVRYNRY
FT                   DVGGFDYGFEADATRFTLASDDVTQGTRFVFNPFVSYPVVRPGWFFTPKIKWHFASYDL
FT                   TSIASDAPTGQPHSVNVNVPTLSLDSGMTFERAVRLWGGSYIQTLEPRLHYVYTPYRNQ
FT                   TYVPLFDTTEADFGLGELFTDNAFVGNDRVSDESRVTAALTSRLIDAATGDERARFVIA
FT                   QRYDFIQPRVTLYDTESTANVARTSLIAGSSIKVGPDLILQNALQYSQSDNYLTQGSIG
FT                   FAWAPATAHVVNVAYRYTRANTTLDFQPVNQIIVSGQWPLAKNMASVARINYDMSTHRL
FT                   IAGLLGLQYDAQCWSLSLGMEKYTNATGSTSPSTGTRMLMQLQLKGLSRTDRGLLDQFK
FT                   ADVPGYSSTPADETPVSRFSEYQ"
     ttgatattcc gcagagaagt ccagggcctc gcaatcaggc ctattgccgc gctcgtgctg        60
     tgtctgctcg cgcctgttgc tgtgcacgcg cagcttgtgg gcgacgcggc cagcgctgaa       120
     cgtctgtccg acgcttggag cttgcgcttc gcgccacaac tgaccgaaac gcccagtgtg       180
     ccgggcgtca aagccgcgac gatcggcttg ggcgatgccg tcaccggcac ggtcgattcc       240
     gacgtgtcgc tcaagggcgc agccgagttg cgccgctatg gtttcgtcgt caaaggcgat       300
     gcgctgcact acgacgtcga cggcgatatg gcggatgcat atggccatgt cagcatcgtt       360
     tcgaagggcg acgtgttcac aggaccgttc ggccagctgc acgtggacgc cagcgaaggc       420
     atcatcgcgc agccccgata ccgcttctat ctgaacggcg gctggggcag cggccggcgc       480
     gccgaactgc tcgacaacga gcgttcgaag atagaagacg gcacctatag cacctgcgat       540
     tgcgacggga acccggcgtg gtacatccgc gcttcgcagt tcgcgatgga ccgcggcgct       600
     gacgaaggcg tcgcgcacaa tggcgtgctg tactttcaga acattccatt gcttgccagc       660
     ccgtggctgt cgtttccgct cgacggcgcg cgacgcagcg gcctgctgtc gccgacgtgg       720
     tcgatgagtt cgaagaacgg cgtagacatc accgtccctt actatttcaa cgttgcgccg       780
     aactacgacc tgaccattgc gccgcgttac atgtcgaaac gcggtgaaat gcttagcgca       840
     gactaccggt atctgacgga agcctcatcc ggttcgctat ccatcgcgta tctgcccaac       900
     gacatcacga cgcatgagcg ccgttattcg atcgacctga atcacatctg gaggctgggc       960
     tccggcttcg cggcgtatgt gaattacaac cgcgtgtcgg atgcgaacgt gtcgaccgat      1020
     ctgggttcag gcagcgcgtt tccgaccagt tcgaccacgc tttatcagca ggaagcaggg      1080
     ctaacctaca acaacggacc gtggtcggtg ctcgcgcgcg agcagcactg gcagtctttt      1140
     tcgagcgata cgacgtacaa ccgcgagccg caggtcaatg tgcgttacaa ccggtatgac      1200
     gtcggcggct tcgattacgg gttcgaagcg gacgcgacgc gcttcacgct tgcatcggac      1260
     gatgtgacgc aaggcacgcg tttcgttttc aatcctttcg tcagctatcc ggtcgtgcgg      1320
     ccgggctggt tctttacgcc gaagatcaaa tggcatttcg cgtcttacga tctcacgtcg      1380
     atcgcatcgg atgcacccac cggacagccg cacagtgtga acgtcaatgt gccgaccttg      1440
     agcctcgact cgggcatgac gttcgaacgc gcggtgcgcc tctggggcgg ttcgtacatc      1500
     cagacgctgg agccgcgcct gcactatgtg tacacgcctt atcgcaacca gacctacgtg      1560
     ccgctcttcg acacgacgga agccgacttt ggcctggggg aactgttcac cgataacgcg      1620
     tttgtcggca acgaccgtgt gtccgatgaa agccgtgtga cggctgcgct gacgtcacga      1680
     ctgatcgacg ctgcaacggg cgacgagcgc gcgcgcttcg taattgcgca gcgttacgat      1740
     ttcatccagc cgcgcgtcac gctctacgac acggaaagca cggcgaacgt cgcgcgcacg      1800
     agtctgattg ctggcagctc gattaaggtc ggccctgatc tcatcctgca gaatgcattg      1860
     caatacagcc agtcggacaa ttatctgacg cagggctcga tcggcttcgc atgggcgcct      1920
     gcaacggcgc acgtagtcaa tgtcgcgtat cgctacacgc gcgctaacac gacgctggat      1980
     tttcagcccg tcaaccagat catcgtgtcg gggcaatggc cgctggcgaa aaacatggcc      2040
     agtgttgcac gcatcaacta cgacatgagc acgcatcgtc tgatcgcagg tctgcttggg      2100
     ctgcaatacg acgcgcaatg ctggtcgctc tcgctcggca tggagaagta cacgaacgcg      2160
     acgggtagca cgtcgccgag cacgggcacg cgcatgctga tgcaactgca attgaagggc      2220
     ctgtcgcgga ccgatcgcgg cctgctcgac cagttcaagg ccgatgtacc cggctattcg      2280
     tcgacgcccg ccgatgaaac gcctgtttcc cgctttagcg aatatcaatg a               2331
//

If you have problems or comments...

PBIL Back to PBIL home page