(data stored in ACNUC29543 zone)

EMBL: CP001044.PE365

CP001044.PE365       Location/Qualifiers
FT   CDS_pept        408148..410457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3485"
FT                   /product="outer membrane protein assembly complex, YaeT
FT                   protein"
FT                   /note="TIGRFAM: outer membrane protein assembly complex,
FT                   YaeT protein; PFAM: surface antigen (D15); surface antigen
FT                   variable number repeat protein; KEGG: bxe:Bxe_A1690
FT                   putative outer membrane antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72634"
FT                   /db_xref="GOA:B2JLK1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK1"
FT                   /protein_id="ACC72634.1"
FT                   /translation="MKQRASTICLASALTVCATTLTPSIAHADDSMIVMDIRLEGLRRI
FT                   EAGTLLANLPIKRGEVFTDDKASAAVRAIYDTGLFNDVNVSLDGDVVVVHVVERPAIAD
FT                   IDFAGIHEFEKDNLTKALKAVGLSRGRPFDKALIDKAEQELKRQYLTRGYYAAEVQTTT
FT                   TPVDSGRVSILFSVIEGPNAKIRQINFIGNRVFSESTLRDEMELSTPNWFSWYTKNDLY
FT                   SKEKLGADLDRLRSYYLNRGYLEFRIDSTQVSLTPDKKEMYLTLNVHEGKPYTITGIRL
FT                   AGNLLDREGELTPLIGIKPGEKFSEDKLRATTKAVVDRLGEYGYAFATVNAVPRIDQDK
FT                   HTVDLTLQVDPGRRVYVRQVNVEGNTRTRDEVIRREMRQLESAWFDSNRLALSKERVNR
FT                   LGYFTDVDVTTVPVSGSNDQVDVDVKVTEKPTGAITLGAGFSSSDKVVLSAGVSQDNVF
FT                   GSGTSLAVNVNTAKTYRTLSVTQTDPYFTVDGIKRISDVYYRTSYPLYYSNDESFRIVS
FT                   LGADLKFGIPFSEIDTVYFGLGIEQDRFNTDSSTPQAYLDYVKEFGRVVNNVPITAAWS
FT                   RDARDSALMPSRGYMLQANGEVGTPAGETEYYKADVQSQYYYSFARGFILGLNLQAGYG
FT                   NGFAGKAYPIFKNYYAGGIGSVRGYESSSLGPRDSSTGDSIGGSKMVVANVEMTFPLPG
FT                   SGWDRTLRVFTFVDAGNVWGNEGSSTGANGLRYSYGAGLEWISPIGPLKLSVGFPIVRH
FT                   ADDKYQVFQFQIGTSF"
     atgaaacaaa gagcatcaac tatctgtctc gccagcgcgc tcaccgtgtg cgccacgacg        60
     ctgacgccat cgatcgcgca tgccgacgat tccatgatcg tcatggacat ccgcctcgaa       120
     ggcctgaggc gcattgaagc ggggacgctg ctcgcgaatc tgcccatcaa acgcggtgaa       180
     gtgttcacgg acgacaaggc atcggcggcc gtgcgggcga tctacgatac gggtctgttc       240
     aacgacgtca acgtatcgct cgacggcgat gtagtggtcg tgcacgtcgt cgagcgtccg       300
     gctattgctg acatcgattt cgccggcatt cacgagttcg agaaagacaa tctgaccaag       360
     gcgctgaaag cagtgggtct gtcgcgcggc cgtccgttcg acaaggcgct gatcgacaag       420
     gccgaacagg aactgaaacg ccagtacctc acgcgaggct actacgccgc cgaagtgcaa       480
     accacgacca cgcctgtgga tagcggacgc gtatcgatac tcttctcggt gatcgaaggc       540
     ccgaatgcga agatccggca gatcaatttc atcggcaatc gtgtgttttc ggaaagcacg       600
     ctgcgcgacg aaatggaact gtcgacgccg aactggtttt cctggtacac gaagaacgat       660
     ctatactcga aagagaagct cggcgccgat ctcgaccggc tgcgttccta ctatctgaac       720
     cgcggctatc tggagttccg gatcgactcg acgcaggttt cgctgacgcc cgacaagaag       780
     gagatgtacc tgacgctcaa cgtgcacgaa ggcaagcctt atacgatcac gggcatccgg       840
     ctcgccggca atctgctcga tcgcgaaggg gaattgacgc cgttgatcgg catcaagccc       900
     ggcgaaaagt tctccgaaga caaactgcgc gcgacgacaa aagcggttgt ggaccggctc       960
     ggcgaatatg gctacgcgtt cgcgacggtg aatgcagtgc cacgaatcga tcaggacaag      1020
     catacggtcg atctcacgct gcaagtcgat ccaggccgcc gcgtctatgt gcggcaggtg      1080
     aacgtggaag gcaacacgcg cacgcgcgac gaagtgatac gccgtgaaat gcgccaactg      1140
     gaaagcgcat ggttcgattc gaatcggctc gcactgtcga aggaacgcgt aaaccgtctc      1200
     ggctatttca ccgacgtgga cgtgacgacg gtgcccgtct ccggctcgaa cgatcaggtc      1260
     gatgtcgacg tcaaggtcac ggaaaagccg acaggggcaa tcacgctggg cgcgggtttt      1320
     tcttcgtcgg acaaggtggt gttgtcggcg ggtgtttcgc aggacaacgt cttcggctcg      1380
     ggcacgagtc tcgccgtcaa cgtgaatacg gcgaaaacgt atcgcacgct gtcggtcacg      1440
     cagaccgacc cctatttcac ggtggatggc atcaagcgca tttcggatgt ctattaccgc      1500
     acgagttatc cgctgtatta cagcaacgac gagagctttc gtatcgtctc gctcggcgca      1560
     gacctgaagt tcggcattcc gttttcggag atcgatactg tctacttcgg gctcggtatc      1620
     gagcaggatc gcttcaacac cgattcgtcg acgccgcagg cctatctcga ctatgtcaag      1680
     gaattcggcc gagtcgtcaa caacgtgccg attaccgcgg cctggtcgcg cgatgcgcgt      1740
     gacagcgcac taatgccgag ccgcggttac atgctgcagg ccaacggcga agtcggcacg      1800
     ccggcgggtg aaaccgagta ctacaaagcc gatgtgcaga gccagtacta ctactcgttc      1860
     gcgcgcggct tcattctggg cctgaatttg caggccggct acggcaatgg gttcgccggc      1920
     aaggcctatc cgatcttcaa gaactactat gcaggcggta tcggttcggt gcgcggttat      1980
     gaatcgagtt cgctggggcc gcgcgattcg tcgacgggcg attcgatcgg cggatcgaag      2040
     atggtggtcg ccaacgtcga gatgaccttt ccgctgccgg gcagtggctg ggaccgcacg      2100
     ctgcgcgtct tcaccttcgt cgatgcgggc aatgtatggg gcaacgaagg cagcagcacg      2160
     ggcgcaaacg gcttgcgata cagctatggc gctgggcttg aatggatttc gccgattggg      2220
     ccgttgaagt tgtcggtcgg gtttcccatt gtgcggcacg cggacgataa gtatcaggtc      2280
     tttcagtttc agattgggac ttcgttctga                                       2310
//

If you have problems or comments...

PBIL Back to PBIL home page