(data stored in ACNUC29543 zone)

EMBL: CP001044.PE371

CP001044.PE371       Location/Qualifiers
FT   CDS_pept        complement(421323..424481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3491"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   bxe:Bxe_A0709 RND family hydrophobe/amphiphile efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72640"
FT                   /db_xref="GOA:B2JLK7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLK7"
FT                   /protein_id="ACC72640.1"
FT                   /translation="MAKFFIDRPIFAWVIAIILMLAGIASIFNLPISQYPTIAPPAVQI
FT                   SATYPGASAKTVENTVTQVIEQQMSGLDHLLYMSSSSDDSGSATITLTFEAGTNPDIAQ
FT                   VQVQNKLQLATPLLPESVQQQGTKVTKSSSSFLLVMAFVSTDGSMDRYDLANYVASHVE
FT                   DPVSRVNGVGTVQLFGSQFAMRVWLDANKLNQYSLTPVDVETALTNQNVQVAAGSLGGT
FT                   PSVPGQVLQATITQATLLQTPEQFGNVLLKVNQDGSQVRVKDVARIELGGENYNFDTEY
FT                   NGQPTAGFGIQLATGANALETATLVRAKIDQLSKNFPHGLVVKYPYDTTPFVKMSIEEV
FT                   VKTLLEGIVLVFLVMYLFLQNLRATLIPTIAVPVVLLGTFAIMSAAGFSINTLSMFGLV
FT                   LAIGLLVDDAIVVVENVERVMSEEGLSPREATRKAMGQITGALVGVALVLSAVFVPVAF
FT                   SGGSVGAIYRQFSLTIVAAMVLSVLVALVLTPALCATILKPVPKGHHGAKTGFFGWFNR
FT                   TFDNGRDRYHSGVQHVIRRSGRWLVLYVVVIVAVGFLFMRLPKSFLPDEDQGTMFVLVQ
FT                   TPPGSTQETTARTLKNVTDYLLNDEKDIVESVFTVNGFSFAGRGQNAGLAFVRMKDYSV
FT                   RQHANQKVQALVGRVFGHYASYKDATVLAVNPPSIPELGTASGFDFELTDNASLGHEAL
FT                   MAARNQLLGMAAKDPSLALVRPNGLSDTPQFKIDIDREKAQALGVTVSDIDQTFSIAWA
FT                   SAYVNNFLDTDGRIKKVYLQGDAPFRMTPEDMSKWYVRGSSGTMMPLTSVASGHWIYGS
FT                   PKLERYNGIASVELQGQAAAGKSTGQAMSAMEALAAKLPQGIGYEWTGLSFQERQSGSQ
FT                   APILYGISILVVFLCLAALYESWSIPFAVILVVPLGVIGALLAVTMRGLENDVFFQVGL
FT                   LTTVGLSAKNAILIVEFARELQTNERMTAMQAALEASRLRLRPILMTSLAFVLGVLPLA
FT                   ISNGAGSSSQHAIGTGVIGGMLTATFLAVFMIPMFYVVIRSKFSRDGATPNSTEPDVEE
FT                   ETAQ"
     atggcaaagt tttttatcga ccggcccatc tttgcgtggg tcattgcaat catcctgatg        60
     ctcgcgggca tcgcctccat cttcaacctg cccatctcgc agtatccgac gattgcgccg       120
     ccagccgtgc agatcagcgc gacgtacccg ggcgcatcgg cgaaaacggt tgaaaacacc       180
     gtcacgcagg tgatcgaaca gcagatgagc ggtctcgacc atctgctgta catgtcgtcg       240
     agcagcgacg actccggcag cgcgaccatc acgctgacct tcgaggcggg cacgaacccg       300
     gacatcgcgc aggtgcaggt gcagaacaag cttcaactcg cgacgccgct gctgcccgaa       360
     agcgtgcagc agcagggcac gaaggtcacg aagtcgagca gcagcttcct gctggtgatg       420
     gcgttcgtgt cgacggacgg cagcatggac cgctacgacc tcgcgaacta tgtcgcgtcg       480
     cacgtggaag acccggtgag ccgcgtcaac ggcgtcggca ccgtgcagct gttcggctcg       540
     cagttcgcga tgcgcgtctg gctcgacgcg aacaagctga accagtacag cctcacgccc       600
     gtcgatgtcg aaaccgcatt gaccaatcag aacgtgcagg tcgcggcggg ctcgctcggc       660
     ggcacgcctt ccgtgcctgg ccaggtgctg caggcgacga tcacgcaggc gaccctgctg       720
     caaacgcccg agcagttcgg caatgtgctg ctgaaggtga accaggacgg ctcgcaggtg       780
     cgcgtcaagg acgtcgcgcg cattgagttg ggcggcgaaa actacaactt cgacaccgag       840
     tacaacggcc agccgacggc aggcttcggt atccaattgg cgacgggcgc gaacgcgctc       900
     gaaacggcga cgctggtgcg cgcgaagatc gaccagttgt cgaagaactt cccgcacggc       960
     ctggtcgtga agtatccgta cgacacgacg ccgttcgtga agatgtcgat cgaggaagtg      1020
     gtgaagacgc tgctcgaagg catcgtcctc gtgttcctcg tgatgtacct gttcctgcag      1080
     aacctgcgtg cgacgctgat tccgacaatc gcggtgcccg tcgtgctgct cggcacgttc      1140
     gcgatcatga gcgcggccgg cttctcgatc aatacgctgt cgatgttcgg tctcgtgctc      1200
     gccatcggtc tgctggtgga cgatgcgatc gtggtcgtgg agaacgtcga gcgcgtgatg      1260
     tccgaagaag ggctgtcgcc acgcgaagcg acgcgcaagg cgatgggcca gatcacgggc      1320
     gcactagtcg gcgtggcgct ggtgctgtcg gcggtgttcg tgcccgtggc cttctcgggc      1380
     ggctcggtgg gcgcgatcta tcgacagttc tcgctgacga tcgtcgccgc gatggtgttg      1440
     tccgtgctgg tcgcgctggt tctcacgccc gcgttgtgcg cgacgattct caagccggta      1500
     ccgaagggcc atcacggcgc gaagacgggc ttcttcggct ggttcaaccg caccttcgac      1560
     aatggccgcg accgctatca cagcggcgtg cagcatgtga tccgccgctc cgggcgctgg      1620
     ctcgtgctct atgtcgtcgt gatcgtcgct gtcggcttcc tgttcatgcg tctgccgaag      1680
     tcgttcctgc ccgatgaaga tcagggcacg atgttcgtgc tggtgcagac gccgcccggc      1740
     tcgacgcagg agaccacggc gcgcacgctg aagaacgtca ccgactatct gctcaacgac      1800
     gagaaggaca tcgtcgaatc cgtcttcacc gtgaacggct tcagcttcgc gggccgcgga      1860
     cagaacgcgg gtctcgcgtt cgtgcggatg aaggactact cggtgcgcca gcatgccaac      1920
     cagaaggtgc aggcgctggt gggccgcgta ttcggtcatt acgcgtcata taaggacgcg      1980
     accgtgctcg ccgtgaaccc gccgtccatt ccggaactcg gcacggcgtc gggcttcgac      2040
     ttcgaattga cggacaacgc gtcgctcggt cacgaagcct tgatggcggc gcgcaaccag      2100
     ctgctcggca tggccgcgaa ggatccgtcg ctggccctcg tgcgtccgaa cggactgtcg      2160
     gatacgccgc agttcaagat cgacatcgac cgcgagaaag cgcaggcgct cggcgtcacg      2220
     gtgtcggata tcgaccagac gttctcgatt gcgtgggcgt cggcgtacgt aaacaacttc      2280
     ctcgacaccg atggccgcat caagaaagtt tatctgcaag gcgatgcacc gttccgcatg      2340
     acgccggaag acatgagcaa gtggtacgtg cgcggcagtt cgggaaccat gatgccgctg      2400
     acgtcggtgg cgtcgggcca ctggatctac ggctcgccga agctcgaacg ctacaacggc      2460
     atcgcatcgg tcgagctcca gggccaggcc gcggcaggca agagtaccgg ccaggcgatg      2520
     tccgcgatgg aagcgctggc cgcgaagctg ccgcaaggca ttggctacga atggacgggt      2580
     ctgtcgttcc aggagcgcca gtcgggctcg caggcgccga ttctgtacgg catttcaatt      2640
     ctcgtcgtgt tcctgtgtct cgccgcgctg tatgagagct ggtcgattcc gtttgcggtg      2700
     attctggtgg tgccgctcgg tgtgatcggc gcgctgctcg ccgtgacgat gcgcgggctc      2760
     gagaacgatg tcttcttcca ggtcggcctg ctgacaacgg tcggtttgtc cgcgaagaac      2820
     gcgattctga tcgtcgagtt tgcgcgcgag ttgcagacca acgaacgcat gacggccatg      2880
     caggccgcac tggaagcgtc gcgtctgcgt ttgcgtccga tcctgatgac gtcgcttgcc      2940
     ttcgtgctcg gcgtgctgcc gctcgcgatc agcaatggcg ccggttcgtc gagccagcac      3000
     gcgatcggca cgggtgtgat cggcgggatg ctgacggcca cgttcctcgc cgttttcatg      3060
     atcccgatgt tctacgtcgt gatccgctcg aaattctcgc gcgacggcgc gacccccaac      3120
     agcaccgagc cggacgtcga agaggaaacg gctcagtga                             3159
//

If you have problems or comments...

PBIL Back to PBIL home page