(data stored in ACNUC29543 zone)

EMBL: CP001044.PE375

CP001044.PE375       Location/Qualifiers
FT   CDS_pept        427562..428815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3495"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bvi:Bcep1808_4762 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72644"
FT                   /db_xref="GOA:B2JLL1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL1"
FT                   /protein_id="ACC72644.1"
FT                   /translation="MKNPFNTLFGRLATLTVGLIVAVHVTSLIVVDRERGQIDADHVRR
FT                   AVMLAVQAKHDGEASARHLAQTLGIEYIAAADVDRSGCPNGCTGSAAPFEHDLLPRMPE
FT                   GSRVVFDPHTGSLWIRYGNEPYWLFMRNANLPGMRFVGSSLVMLVLAVCAALFAAWQFQ
FT                   RPLHRLADAAREFRIGRRVPPVTESGPAEMRSLIGDFNEMMSELGKAEQERAVMLAGVA
FT                   HDLRAPITRMQVRADLLPDAANRSGFLRDAESLSRIVTQFLDYARDTADPSPQTNVDAH
FT                   CRRHYGDGLDDEALVRLHLNAGDGFNLPLVDLDRILSNLIENAMNYGDPPVEISTSAHS
FT                   GVYTLTVHDHGVGIPRGQLERALQPFTRLDPARGGDAHCGLGLAIVRRLTRYNGGQFEC
FT                   DNAPEGGFRVTLTFRREA"
     atgaagaacc cgttcaatac gctcttcggc cgtctcgcga cgttgacggt cggcctgatc        60
     gtggccgtgc acgtgacgtc gctgatcgtc gtcgaccgcg agcgcggtca gatcgatgcc       120
     gaccatgtgc gccgcgccgt catgctcgcc gtgcaggcaa agcatgacgg cgaagcatct       180
     gcgcggcacc tcgcgcagac gctcggcatc gaatatatcg ccgcagccga cgtggaccgt       240
     tccggctgtc cgaacggttg caccggctcc gctgcaccgt tcgagcatga cctgttgccg       300
     cgcatgcccg aaggcagccg cgtcgtgttc gatccccaca ccgggtcgct gtggatacgc       360
     tacggcaacg aaccgtactg gctcttcatg cgcaatgcca atctgcccgg catgcgcttt       420
     gtcggttcgt cgctggtgat gctggtgctg gccgtgtgcg cggcgctgtt cgccgcgtgg       480
     cagttccagc gtcccttgca ccggctcgcg gatgcggcgc gcgaatttcg gatcggacgg       540
     cgcgtgccgc ccgtcacgga aagcggtccc gccgaaatgc gctcgctgat cggcgatttc       600
     aacgagatga tgagcgaact cgggaaagcc gagcaggagc gcgcggtgat gctggcgggc       660
     gtcgcacacg atctgcgtgc gccgatcaca cgcatgcagg tgcgcgcgga cctgctgccc       720
     gacgcggcca atcgcagcgg ctttctgcgc gatgccgaat cgctgtcgcg catcgtgacg       780
     cagtttctcg actatgcgcg cgacacggcc gatccgtcgc cgcaaacgaa tgtcgacgcg       840
     cattgccggc gtcactatgg cgacggactc gatgacgaag cgctcgtgcg cctgcatctg       900
     aatgcgggcg acggcttcaa cctgccgctc gtggatctcg accggattct gtcgaacctg       960
     atcgaaaatg cgatgaacta tggcgacccg cccgtcgaga tttcgacgtc cgcgcatagc      1020
     ggcgtctata cgctcacggt gcacgatcat ggcgtcggca ttccgcgcgg tcaactcgaa      1080
     cgcgcgctgc agccgttcac gcggctcgat ccggcgcgcg gcggggatgc gcattgcggc      1140
     ctgggtctcg cgatcgtgcg acggctcacg cgttataacg gcggacagtt cgaatgcgat      1200
     aacgcgcctg aaggcggatt tcgcgtgacg ctgacgttcc gtcgcgaggc ctag            1254
//

If you have problems or comments...

PBIL Back to PBIL home page