(data stored in ACNUC29543 zone)

EMBL: CP001044.PE378

CP001044.PE378       Location/Qualifiers
FT   CDS_pept        complement(430094..431242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3498"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   rru:Rru_A2445 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3498"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72647"
FT                   /db_xref="GOA:B2JLL4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL4"
FT                   /protein_id="ACC72647.1"
FT                   /translation="MNLSFDLRPGWNLERHESLAVLHLRGDWITCATGVRSAAEVHEIV
FT                   KAVGACALRLETSNLGRWDSALIVFLMMLRESVRKGGTRPFEIDESDLPHAAQRLLALA
FT                   AAGSGEVAGIAAVHRSLATQVGEAYFQAWANAVSIVALVGETALHCTAAFAHRVRTRGV
FT                   DVLQLMREAGAGALAIVAIVNGLVGAILAFIGAVQFQRFGAGIYVANLVGIAVVREMAA
FT                   LATAIVMAGRTGGAYAAHLATMQGNEEIDALNAVGIPVFDFLVLPRVIALVSMMPLLYV
FT                   YSCAVGLLSGFIVTLATLDITAVTYLQQLRGAVDGVQFAIGLAKSIAFGSFVALAGCHI
FT                   GLKAGRSAAEVGRAATSAVVVGIVGVISLDAIFAVCTNALGI"
     gtgaaccttt ccttcgacct tcggcctggc tggaatctcg aaaggcacga gagtctggcg        60
     gtgctgcatc tgagaggcga ctggattacg tgcgcgacgg gtgtgcgcag cgccgccgaa       120
     gtccacgaga tcgttaaagc agttggcgct tgcgcactcc gtctggaaac aagcaacctc       180
     ggtcgatggg atagcgcgct tatcgtcttt ttaatgatgc tccgcgaatc ggtcagaaaa       240
     ggagggaccc gcccgttcga aatcgacgag tcggaccttc ctcatgcagc acaacgacta       300
     ctggctctgg cagccgcggg aagtggagaa gtggctggca ttgccgctgt gcatcgctca       360
     ttggcgacgc aagtcgggga agcctatttc caggcgtggg cgaacgcggt gtcgatcgtt       420
     gcgctcgtgg gagaaaccgc actgcattgc accgcagctt tcgcccatcg agtgcggacc       480
     cgcggtgtcg acgttcttca actgatgcgc gaagctggcg ctggagcact tgccattgtg       540
     gcaattgtca acggattggt cggcgcaatt ctcgcattca ttggcgcggt gcagttccag       600
     cgcttcggcg caggaatcta tgtcgccaat ctcgtcggca ttgctgttgt gcgagagatg       660
     gcggcgttgg cgaccgccat tgtgatggca gggcggaccg ggggcgcata cgcggcgcac       720
     ctcgccacca tgcagggaaa cgaggaaatc gatgcactaa acgcggttgg aattccggtc       780
     tttgacttcc tcgtactgcc acgggttatc gcgcttgtct caatgatgcc tttgctctac       840
     gtgtacagtt gtgcggtagg ccttttgagc ggcttcattg tcacccttgc gaccctcgat       900
     atcaccgcgg tgacatacct gcaacaactg cgcggagctg ttgacggggt ccagtttgcg       960
     attggcttgg ccaagagcat cgctttcggc tcgttcgttg ccctagcggg atgtcatatc      1020
     gggttgaagg ctggacgtag cgcggcggag gtcggtcgcg cggcgacctc agcggttgtg      1080
     gtgggcatcg tcggggtcat ttcgctcgat gccatatttg ccgtctgcac gaacgcgctg      1140
     ggaatatag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page