(data stored in ACNUC29543 zone)

EMBL: CP001044.PE383

CP001044.PE383       Location/Qualifiers
FT   CDS_pept        435639..436424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3503"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: cyb:CYB_1806
FT                   potassium transporter, voltage-gated ion channel (VIC)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72652"
FT                   /db_xref="GOA:B2JLL9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLL9"
FT                   /protein_id="ACC72652.1"
FT                   /translation="MYRIEEPRLGGLRIQEWRRRAHLAVGMLFLVLLGSTLGIELLDHT
FT                   DAPVSTKTFTAFWDAVNLITTLGDFSDFNADQKIFMLVAILVTVVIAGYALRQLAGMLS
FT                   GDDVMIFWENRVMEHKLEALINHVAVCPFGPVGQMVAARLRDAGSTVLVLDSDAKQADK
FT                   ASRLGYMVMLGDQNSFDDILARARLDTASTLFLTGSDPNSNLEITLVAHTLNPALQIVV
FT                   SGENDLRRMLLRKAGASTVIDQNDIVACAMVGQVDAQPA"
     atgtaccgga tcgaggaacc tcggcttggt ggactgcgta tccaggaatg gaggcggcgt        60
     gctcatctgg cggtcggcat gttgtttctg gtgctgctgg gatcgacgct tgggattgag       120
     ctactcgacc acacggatgc gccagtaagc acgaagacgt tcacggcttt ttgggatgcg       180
     gtcaacctta ttacaacact tggcgatttc tcagacttca atgcggacca gaagatattc       240
     atgctggtcg ccattctcgt aacggtggtt attgctggat acgcgttgcg gcaactagcc       300
     ggcatgttgt caggtgacga cgtgatgatc ttctgggaga acagagtcat ggagcacaag       360
     cttgaagcac tgatcaacca tgtcgcggtt tgcccgtttg gcccggttgg ccagatggtc       420
     gccgcccgtc tccgcgatgc gggatcgacc gtgctcgtcc tcgattccga tgcgaagcag       480
     gccgacaaag catcccgact gggatatatg gttatgctgg gcgatcagaa ttcgttcgac       540
     gacatactcg cacgtgccag gctggatact gccagtaccc tgtttctgac gggctccgat       600
     cctaacagta atctggagat cacgctggtg gcgcacacac tgaatccggc gctccagatc       660
     gtggtatcag gagagaacga tctccgcagg atgttgctcc gaaaggcagg tgcctcgacc       720
     gtcatcgacc agaacgacat tgttgcctgc gcgatggtcg ggcaggttga tgcgcaaccg       780
     gcgtaa                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page