(data stored in ACNUC29543 zone)

EMBL: CP001044.PE386

CP001044.PE386       Location/Qualifiers
FT   CDS_pept        complement(441812..442906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3506"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   tbd:Tbd_2532 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72655"
FT                   /db_xref="GOA:B2JLM2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM2"
FT                   /protein_id="ACC72655.1"
FT                   /translation="MKNLLRALFAAVPSAAMLVACGSKPAPDALRAVRTAEIRYDETLV
FT                   TDRYVGTVQPRHEVIEAFRVGGKVVKRKVDVGQKVREGDVLAVLDDTDYRLAEEAARQQ
FT                   LAAAISQARLAESDRRRLNSLKTDGSVSVSDDEKAQTGAQTTSSAAEAEGKKLELARNR
FT                   LKYTVLRASQSGVITSVRFEAGEVVAEGQPMVSIANAGEPEIVADLPEDRLSTFKTARY
FT                   KAWLASAPEQSFDVVLRELSPQATAQTRTYRARLKPAMPRALPLGATATLVVERPVGDA
FT                   SAAVIPASAITQNKGQPAVWVVHRVGSEPVGTVELIGVSVHGYRNDDVLVSGPPAGELI
FT                   VTAGVQKMAPGLKVALAETRQSVR"
     atgaaaaact tgctacgtgc actgttcgcg gccgtgccga gcgctgcgat gctggttgcg        60
     tgcggatcga agcccgcccc cgatgcgctt cgtgcggtcc gcactgccga gatccgctac       120
     gacgagactc tggtgaccga ccgttacgtg ggcaccgtgc agccgcgcca tgaagtcatt       180
     gaggcttttc gcgtcggcgg gaaggtcgtc aagcgcaagg tcgacgtcgg ccagaaggtt       240
     cgcgagggcg acgtgctcgc ggtgctcgac gataccgact atcgactcgc cgaggaagca       300
     gcacggcagc aactggccgc ggccatttcg caggcccgac tggccgagtc cgatcggcgg       360
     cgtctcaatt cactcaaaac cgacggctca gtgagcgtat ctgacgatga gaaggcgcag       420
     accggtgcgc agacaacgtc gtcggcggct gaagccgaag ggaagaaact cgagctcgca       480
     cgcaatcggt tgaaatatac ggtgctgcgc gcgtcgcaga gtggcgtcat cacctccgta       540
     cgtttcgaag caggggaggt cgtggccgag gggcagccga tggtttccat cgccaacgca       600
     ggcgagcccg agatcgtcgc cgacctgccg gaagatcgtc tctcaacgtt caagacggcg       660
     cgatacaagg cgtggctcgc tagcgcgccc gaacaaagct tcgacgtcgt gttgcgggaa       720
     ctctctccgc aggctaccgc gcaaacccgt acctaccgtg cgcgcctgaa acctgcgatg       780
     ccgcgagcgt tgccactcgg tgcgaccgcc acgctggtgg tcgagcgtcc ggtcggcgac       840
     gcatcggcag cagtgattcc tgcctcggcc atcacgcaga acaagggcca gcccgccgtc       900
     tgggtggttc atcgtgtggg ttccgagccg gtgggcacgg tcgagctgat cggtgtctcg       960
     gtgcacggct atcgtaacga cgatgtgctc gtgtccggac cgccggctgg cgagctgatc      1020
     gtcacggcag gcgtgcagaa gatggccccg ggcctgaagg tcgcgcttgc cgaaaccagg      1080
     caatctgtcc gatga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page