(data stored in ACNUC29543 zone)

EMBL: CP001044.PE387

CP001044.PE387       Location/Qualifiers
FT   CDS_pept        complement(442903..444375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3507"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: pca:Pcar_0814 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72656"
FT                   /db_xref="GOA:B2JLM3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLM3"
FT                   /protein_id="ACC72656.1"
FT                   /translation="MAGRSAAAAAVVSLALLLASCATPVMQPAIEVPGRFAAASASAEE
FT                   PEAAWWDSYGDPVLSDLVRRAAQENRDVRIAAERVRAARAGETISRSWLLPTLSVGAMG
FT                   FNHTTNYDTVLKNFVPEAANTRAGQVGIGASWEVDVFGRLRAGAAAAAADTIAVQNTAR
FT                   GVRLLVLTDVATNYFTLVGALRQLETVRAISAAQDETLRLVTARERVGLATPFDVERVK
FT                   TEASRTHAAIPPLETLAAVSRHHIAVLVGDQASNAASITPSGVGAIVPPARPGQPATLL
FT                   QRRPDLLVASAQLDAANARRQQAMAEWFPRLFLGAVFGRESIDLNGIALGPARFSNVAG
FT                   LIAMPIFNAGRTQAINDIAEIGQKEAVLHYEDAIVRALEDVENALVALDDERQRAQLLE
FT                   NAATTAEAALGRAQSLYNRGQTDLLPLLDAQRTRLAVRAIANDSSTQLLLDSVQLYKAL
FT                   GGGWEVFEAAPAPDGTAPSHSSSNVDRDEGPS"
     gtggcagggc gcagcgcagc cgccgcggcg gttgtgtcgc tggcgcttct tctggcaagt        60
     tgcgcgacgc cagtgatgca gcctgcgatc gaggttcccg ggcggttcgc ggctgcgtcc       120
     gcatctgcgg aggagccgga ggccgcttgg tgggatagct atggcgatcc ggtgctttcc       180
     gatctggtcc gtcgggcggc gcaggagaac cgggacgtcc ggatcgcggc ggagcgcgtg       240
     cgggccgcga gggccggaga aacaatcagt cgttcgtggc tcctgccaac tttgagcgtt       300
     ggtgccatgg gttttaacca cacgacgaac tacgataccg tcctcaaaaa cttcgttccc       360
     gaagcggcaa atacgcgagc gggacaggtc ggtatcggtg cctcgtggga agttgacgtc       420
     ttcggccggc tgcgggcggg tgcggccgcg gctgcagccg acacgatcgc agttcagaat       480
     accgcgcgcg gcgtgcgcct tcttgtgctg accgatgtcg ccacgaatta ctttacactc       540
     gtcggcgcat tgcgacagct cgaaaccgta cgcgcaatat cggctgcaca ggacgagacg       600
     ctgcgcctgg tgaccgcccg cgaacgcgtc ggcctcgcga ctccattcga cgttgagcgc       660
     gtgaagacgg aagcttcaag aacgcacgcg gccataccgc cgcttgagac cctggccgcc       720
     gtctcgcgcc atcacattgc ggtgctcgta ggagatcagg cttccaatgc ggcgagcatc       780
     acgccatcgg gcgtcggagc gatcgttccg cccgcacgtc cggggcaacc ggccaccctg       840
     ttgcagcgga ggccggatct gctcgtcgca agcgcacagc ttgacgcggc caatgcgcgc       900
     cggcaacagg cgatggcgga atggtttccg cgtctatttc tcggcgcggt gttcggccgt       960
     gagtccatcg atctcaacgg gattgcgctc ggtccggcgc gcttcagcaa cgtcgccggc      1020
     ctcatcgcga tgcccatctt caatgcgggg cggacgcagg cgatcaacga catcgccgaa      1080
     atcggtcaaa aggaagcggt cctacattat gaggacgcca tcgtacgcgc gctcgaagac      1140
     gtcgagaacg cgctggtcgc gctcgacgac gaacgtcaac gtgcgcaact gctggagaac      1200
     gccgcgacta cggccgaagc ggcgctgggc cgcgcgcagt ccctctataa ccgcggccag      1260
     accgatcttc tgccgctgct cgatgcccaa cggacccggt tggccgtccg tgcaatcgct      1320
     aacgacagca gcacgcaatt gctgctcgac agcgttcaac tgtacaaggc gcttggcgga      1380
     ggctgggagg tgttcgaggc cgctcccgct cctgacggca cagcaccttc ccacagttcg      1440
     tcaaacgtgg atcgggacga gggaccatca tga                                   1473
//

If you have problems or comments...

PBIL Back to PBIL home page