(data stored in ACNUC29543 zone)

EMBL: CP001044.PE395

CP001044.PE395       Location/Qualifiers
FT   CDS_pept        complement(452155..453036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3515"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mav:MAV_2517
FT                   2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72664"
FT                   /db_xref="GOA:B2JLN1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN1"
FT                   /protein_id="ACC72664.1"
FT                   /translation="MDVSSLTSAMTERIVRVGARQIFLTEAGRGPAVLMLHGGGPGASG
FT                   VSNYSRNVEALARRFRVLVPDMPGYGKSTKGLDRGDPFGDLATCMLGMLDSLGIGRAHV
FT                   IGNSLGGACALRMALERPETVGRLVLMGPGGVDTTRQLPTPGLKRLLTYYKGEGPTLEK
FT                   LTRFIRGDLIYDAGLVPESVIRERFRASIDPEVVASPPLLGPKGVPQFRKIDFTRDPRL
FT                   KSVQNPALVLWGTEDKVNRPSGAHSLQRRMANCDVYLFSKTGHWVQWERAEEFNAAVVA
FT                   FLAQDGIKAGTA"
     atggatgtct catctctcac tagcgcgatg accgagcgca tcgttcgggt tggtgcacga        60
     cagatttttc tgacggaagc cggccgtggc ccggcggtgc tgatgcttca cggtggcggt       120
     cccggcgcgt cgggcgtctc aaattactcg agaaacgtcg aagcgctggc ccgtcgtttt       180
     cgggttctgg ttcctgacat gcctggctac gggaaatcga ccaagggcct cgatcgcggc       240
     gatccgttcg gcgacctggc cacctgcatg ctcggcatgc tggactcgct gggaattggg       300
     cgcgcgcacg tgattggtaa ctcgctcggt ggcgcatgcg cgctgcgcat ggcgcttgag       360
     cgcccagaaa ccgtcggccg tctggtgttg atggggccgg gcggcgtgga caccacacgc       420
     cagttgccca ctccggggct caagcggttg ctgacttact acaagggcga gggaccgacg       480
     ctggaaaaac tcaccaggtt tatccgcggc gacctgatct atgacgccgg tctggttcct       540
     gaaagcgtga tccgggagcg ctttcgggcc agcatcgacc ccgaggtcgt agccagcccg       600
     ccgttgcttg gaccgaaggg cgttccgcag ttcaggaaga ttgacttcac acgcgatccg       660
     cgcctgaagt cggtgcaaaa ccctgcactg gtgctctggg gcacagagga caaagtaaac       720
     cgtcccagtg gtgcgcactc gctgcaacga cgcatggcta actgcgacgt gtatctattt       780
     agcaagaccg gccactgggt gcagtgggag cgagccgagg aattcaatgc cgccgtagtg       840
     gcgtttcttg cgcaggacgg cattaaggcg ggtaccgcct aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page