(data stored in ACNUC29543 zone)

EMBL: CP001044.PE396

CP001044.PE396       Location/Qualifiers
FT   CDS_pept        453163..453870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3516"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pla:Plav_1538
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72665"
FT                   /db_xref="GOA:B2JLN2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN2"
FT                   /protein_id="ACC72665.1"
FT                   /translation="MSETTNIDHRTRVAAERRERMRARLIESALLVFAEKGVGASVIQE
FT                   VIAAAGVSQGTFYNYFRTNEELLTAVTQELNDELLRLIETEVGAYADPARRIACGVRLF
FT                   LHAARTYPLLARFICAAGLHVAGPSSLIYVYLPAHIEQGLAEGHFRDVTVKVALDVIAG
FT                   TVLTTIQRFTAEGQECAQPEQAVAAILRSLGVSRSKAQALVHGELVSIAVPAGSLLERG
FT                   HARLQQQMLGSSR"
     atgagtgaaa ccacaaacat cgatcatcga acccgcgtcg cggcggagcg ccgcgagcgg        60
     atgcgcgcaa gacttattga gagcgcactg ctggtttttg cggagaaggg agttggagcg       120
     agcgttatcc aggaagtaat cgcggcggca ggcgtctcgc aaggcacctt ctacaattac       180
     ttccgtacaa acgaagaatt gctcacggcg gttacacagg aactcaacga cgaactcctt       240
     cgcctcatcg aaacggaagt gggtgcatac gccgacccgg cgcgccggat tgcctgtggc       300
     gtccggctgt tcctccatgc ggcgcgcact tacccgctcc ttgcgcgctt catttgtgcg       360
     gctggtctac acgttgcggg gccgagcagc cttatatacg tatatctgcc ggctcatatt       420
     gaacaggggc tggccgaagg tcatttccgc gacgtcacag ttaaagtggc actcgatgtg       480
     atcgccggga cagtgctgac gacgatccag cgcttcaccg ctgaagggca agagtgcgcg       540
     cagcctgaac aggcggtcgc cgccattctt cgaagtctcg gggtcagcag atcaaaggcc       600
     caggctttgg tgcatggcga actcgtgtct atcgcggtac ccgccggttc tctgcttgag       660
     cgggggcatg caaggctcca gcagcagatg ctgggctcat ctcgttga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page