(data stored in ACNUC29543 zone)

EMBL: CP001044.PE397

CP001044.PE397       Location/Qualifiers
FT   CDS_pept        complement(455490..456011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72666"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN3"
FT                   /protein_id="ACC72666.1"
FT                   /translation="MIGLTSRHAETQDNSVAGTSTARQDSDEFVRMRQQVAAADREYDR
FT                   EAAAAKKVYDPRRRKRRRSATPRSRSPITARASRGRLADVAVVAAHYAAAGANERIMNF
FT                   PSRVARQCLTFKGKPPVVAALSVASTTSVYAQKNSCATDTAMNAFGDAAVKDRRYSLNG
FT                   VKTETTMDRE"
     atgataggac tgacgtcccg tcacgctgaa acgcaggaca attcagtagc cggcacatcg        60
     accgcccgtc aagattcgga cgagttcgtg aggatgcgcc agcaggttgc ggcagcggat       120
     cgtgaatacg accgtgaagc tgcggcggcc aaaaaggtgt atgacccaag aaggcggaag       180
     cgaagaagaa gcgcgacgcc gcgatctcgg tcgcctatca cggcgcgggc cagtaggggc       240
     cgtcttgctg atgttgccgt ggtggccgcg cattacgcgg cggcaggcgc taacgagagg       300
     atcatgaatt tcccctcacg cgtcgcccgg cagtgtctaa cgtttaaagg caagcctccg       360
     gtcgtcgccg ctttgtcggt cgcttcgaca acttctgtgt atgcgcaaaa gaattcctgt       420
     gctactgaca cagcgatgaa cgcctttggc gatgcagccg tgaaggaccg gaggtactcg       480
     ttgaacggcg taaaaacgga gacaaccatg gaccgggagt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page