(data stored in ACNUC29543 zone)

EMBL: CP001044.PE398

CP001044.PE398       Location/Qualifiers
FT   CDS_pept        complement(456358..458373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3520"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: glycoside hydrolase family 13 domain protein;
FT                   alpha amylase catalytic region; SMART: alpha amylase
FT                   catalytic sub domain; KEGG: sfu:Sfum_2956 glycogen
FT                   debranching enzyme GlgX"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72667"
FT                   /db_xref="GOA:B2JLN4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN4"
FT                   /protein_id="ACC72667.1"
FT                   /translation="MPEGVNFCIFCRHATHVELLLYEAADSAEPFQVVVLTSEHNRSFF
FT                   YWHVLVENLPPHVCYTWRVDGPHDAQNTGRVFDARRELLDPFAHAVSDLLWDRRKTIES
FT                   ADVANAVYRAIVVESTAAPRLPVARGLDDSIIYELHVGGFTRDPSSGVRHPGTFDGLIE
FT                   KIPYFQQLGVTHLELLPVMAFDEQDVPDPVAARSLVNYWGYSTHSFHSPHPRYCVDPAN
FT                   AVNEFRAMTDAMHAAGIQVLLDVVFNHTAEAGEAGPVINFKGFANDIFYQHDPGDARRY
FT                   LDYTGCGNTVNCNHPLVTAFIVHCLEYWVEEMGVDGFRFDLASVFARDGHGELMIDPPL
FT                   PWAIESSRTLSRVPLIAEAWDAAGLYHVGAFPGMAWAEWNGRYRDVIRRFVRGDAGIIG
FT                   EVATCIAGSADLYADDGRLPGSSVNFVTCHDGFTLNDLVSYNGKHNEANGQENRDGSND
FT                   NLSWNCGAEGETDDAGIVQLRGRQARNLMAILFLSQGVPMMLAGDEVLHSQHGNNNGYC
FT                   QDNALSWFDWRRVESASGMLRFMRELIALRKRHASLRRRRFLTGRPVQGHAHPDIAWHG
FT                   ERLHEPEWQNPRARLLAFTVGGEDPGEALLHVVLNMDDLARQVALPTVLGGKCWYRIID
FT                   TAQASPHDILSAPRKAATELDHCLIQPRTVVVLEAD"
     gtgcccgaag gtgtcaattt ttgcattttt tgccgacatg cgacgcatgt cgaactgttg        60
     ctgtatgaag cggcggatag cgcggagccg ttccaggtcg tcgtgcttac gtccgagcat       120
     aatcgctcgt tcttctattg gcacgtactg gtcgagaacc tgcctccgca cgtctgctac       180
     acgtggcggg tggacgggcc gcatgacgct caaaacaccg ggcgtgtgtt cgacgcccgc       240
     cgcgaactgc tcgatccgtt cgcgcatgcg gtaagcgacc tgctctggga ccggcgcaag       300
     accatcgaat cggcggacgt ggcgaacgcg gtttaccgtg cgatcgtcgt cgaatccacg       360
     gctgcgccgc gcttgccggt tgcgcgcggc ctcgatgact cgatcattta cgaacttcac       420
     gtcggcggct ttacacgcga tccttcgagc ggcgttcggc atcccggcac attcgacgga       480
     ctgatcgaaa agattccgta ttttcagcaa ctcggcgtga cgcacctcga gctgctgccc       540
     gtgatggcgt tcgacgaaca ggatgtgccc gacccggtcg ctgcacgcag tctagtcaac       600
     tactggggct acagcacgca tagttttcac agcccgcatc cgcgctattg cgtcgatccg       660
     gcaaacgccg tgaacgaatt tcgtgcgatg acggacgcca tgcacgccgc gggaattcag       720
     gtgctgctcg acgtggtctt caatcacacg gcagaagcgg gcgaggcggg acccgtcatc       780
     aacttcaagg ggttcgccaa cgacatcttc tatcagcacg atccgggcga cgcacgccgc       840
     tatctcgact acaccggctg tgggaacaca gtgaactgca accatccgct cgtgacggcg       900
     ttcatcgtgc attgcctcga atactgggtc gaagaaatgg gcgtcgacgg cttcaggttc       960
     gatcttgcca gcgtcttcgc gcgcgacggg cacggcgaac tgatgatcga tccgccactc      1020
     ccatgggcga tcgaatcgtc gcgcaccctg tcgcgcgtgc cgctgatcgc ggaagcgtgg      1080
     gatgcggcag gcctttatca cgtcggggcg tttccgggca tggcgtgggc agaatggaat      1140
     ggacgttacc gcgatgtgat tcgccgcttc gtgcgcggcg acgccgggat catcggggag      1200
     gtcgcgacct gcatcgccgg gagcgcggat ctttacgcgg acgacggcag attgccgggc      1260
     agtagcgtga acttcgtcac ctgtcacgac ggctttactc tgaacgacct cgtcagctac      1320
     aacggcaagc acaacgaggc caatggccag gaaaaccgcg acggctcgaa cgacaacctg      1380
     tcatggaact gcggtgcgga aggcgaaacg gatgacgcgg gaatcgtgca actgcgtggc      1440
     cgtcaggccc gcaatctgat ggccatactt tttctgagcc agggcgtgcc gatgatgctc      1500
     gcgggtgatg aagtactcca tagccagcac ggcaataata atggctattg ccaggataac      1560
     gcgctttcgt ggttcgactg gcgtcgggtc gaatccgcat cgggaatgct gcggttcatg      1620
     cgcgaactga tcgcgttgcg caagcgtcac gcaagtctgc gccgacggcg ctttctgacg      1680
     gggcgacccg tgcagggcca cgcgcacccg gacatcgcat ggcacggcga acgcctccat      1740
     gagcccgagt ggcagaatcc gcgagcgcgg cttctcgcat ttaccgtggg cggtgaagat      1800
     ccgggagagg cgctccttca tgtagttctg aacatggacg atttggcacg tcaggtcgcg      1860
     cttcccactg tcctcggcgg aaagtgctgg taccggatca tcgataccgc acaggccagt      1920
     ccgcatgaca ttctttcggc gccacgcaaa gcagcgactg agttggatca ctgtttgata      1980
     cagccgcgta cggtcgtcgt actggaggca gactga                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page