(data stored in ACNUC29543 zone)

EMBL: CP001044.PE40

CP001044.PE40        Location/Qualifiers
FT   CDS_pept        complement(36518..37618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3141"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   bxe:Bxe_B1247 cobalamin (vitamin B12) biosynthesis CbiD
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3141"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72309"
FT                   /db_xref="GOA:B2JRI2"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2JRI2"
FT                   /protein_id="ACC72309.1"
FT                   /translation="MRDETPEQPALLRSGYTTGSCATVTSLAAARLLLSGIASDVAEIV
FT                   LPKGQHVPMKLVFCRLLNDGKDGAEAGTIKDAGDDPDVTHGAIVFARVRLADAPGVRFH
FT                   AGPGVGTVTRAGLTLAVGEPAINPVPRQMMTAHLTDLAAEYGYAGGFEVAIGVENGEAL
FT                   AQKTMNPRLGIVGGLSILGTTGIVRPFSCSAYIASIHQGIDVARANGYRHIAACTGNAS
FT                   EDAMRAYYQLPDIALIEMGDFAGAVLKHLKRAPVDKLSMCGGFGKLSKLAAGHLDLHSR
FT                   NSSIDLRQLAQWCASHAASNATLQAAIVGANTSQEALAMALKEGVPLGDIVCARARDVA
FT                   REIVPASVEVEMFAIDRQGNIVGEAR"
     atgcgcgacg aaacgcccga acaacccgcg ctgctgcgta gcggctacac gacgggaagt        60
     tgcgcgaccg tgacctcgct ggcggcggcg cgcctgctgc tgtcgggtat tgccagcgac       120
     gtcgccgaga tcgtgctgcc gaaaggccag cacgtgccga tgaagctcgt cttctgccgt       180
     ctgctgaacg acggtaagga cggcgcggaa gcgggcacca tcaaggatgc gggcgacgat       240
     cccgatgtca cgcatggcgc gatcgtgttc gcgcgcgtgc gccttgccga cgcgcccggc       300
     gtgcgttttc acgcgggccc gggcgtcggc acggtgacgc gcgcaggctt gacgctggcc       360
     gtcggcgagc cggccatcaa cccggtgccg cgccagatga tgacggcgca tctaaccgat       420
     ctcgctgccg aatacggata cgcaggcggc ttcgaagtcg cgatcggcgt cgagaacggc       480
     gaagcgcttg cgcagaagac catgaacccg cgtctgggca tcgtcggcgg attgtcgata       540
     ctcggcacga cgggcatcgt gcggccgttt tcgtgttcag catatatcgc gtcgatccat       600
     cagggcatcg acgtcgcgcg tgcgaatggc tatcggcata tcgcggcgtg cacgggcaat       660
     gcgagcgaag acgcgatgcg cgcgtactac cagctgcccg atattgcgct gatcgaaatg       720
     ggcgacttcg cgggcgcggt gctcaagcat ctgaagcgcg cgcccgtcga caagctgagc       780
     atgtgcggcg gcttcggcaa actgagcaag ctggcggcgg ggcacctcga tctgcatagc       840
     cgcaactcga gcatcgactt gcgtcagctc gcgcaatggt gcgcgagcca tgcggccagc       900
     aatgccacgt tgcaggccgc gatcgtcggc gcgaacacga gccaggaagc gctcgcaatg       960
     gcgctgaagg aaggcgtgcc gctcggtgac atcgtctgcg cgcgggcgcg cgacgtggcg      1020
     cgcgagatcg tgcccgcgtc ggtcgaagtg gagatgttcg cgatcgaccg gcaaggcaat      1080
     attgtgggag aggcgcgatg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page