(data stored in ACNUC29543 zone)

EMBL: CP001044.PE402

CP001044.PE402       Location/Qualifiers
FT   CDS_pept        complement(465117..466031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3527"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: pla:Plav_1539
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72671"
FT                   /db_xref="GOA:B2JLN8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN8"
FT                   /protein_id="ACC72671.1"
FT                   /translation="MLIEDIEFVTFRHPDLAAVRDFMVDYGLLDLQHDGDALYLRSYGD
FT                   APFSYVSTQGEAAFVGVGFRVSSREALDTLAARFDSPVTDCPHPGGGLYTVGADPDGRR
FT                   LEFVFGAERLPAIPSGGDPIVWNDAHAKNRLGHFQRPAFGPSHIQRFGHVAVFSPDPQG
FT                   VISWYGETLGMKASELIYQGKEKNVVAAFMHLETGAAWTDHHTLAIVGGKAVGLDHASF
FT                   ECRDIDDVGIGHMVMVDKGYKHRWGIGRHFHGSQIFDYWTDPAGFHVEHYVDGDLVNND
FT                   SPTLSYPFGRDTLLQWGPAFPGL"
     atgctcatcg aagacatcga attcgtcact tttcgccacc cggacctggc tgcggtccgc        60
     gacttcatgg tcgattacgg cttgctggat ctccagcacg acggcgacgc gctttatctg       120
     cgcagctacg gggacgcgcc tttctcctac gtctcgacgc aaggcgaggc ggcgtttgtc       180
     ggtgtcgggt tccgcgtgag ctctcgcgag gcgctcgaca cgttggcggc ccgctttgat       240
     tcgcctgtga ccgattgccc gcatccgggc ggcggcctct acacggtggg cgccgatccc       300
     gacggtcgtc ggctggagtt cgtattcggc gccgaacgtc tgccagctat tccgtcgggt       360
     ggcgatccga tcgtctggaa tgacgcccac gccaaaaacc ggctgggcca cttccagcgt       420
     ccggccttcg gcccgtcgca cattcagcgg tttggccatg tggccgtttt ctctccggac       480
     ccgcagggag tgatctcgtg gtacggcgaa acgctcggca tgaaggcgtc ggaactgatc       540
     taccagggca aagagaaaaa cgtagtggcc gccttcatgc acctggaaac gggcgcggca       600
     tggaccgatc accacacact ggccattgtc gggggcaagg cggtgggcct cgatcacgcc       660
     tcctttgaat gtcgcgatat cgatgacgtg ggcatcggcc acatggtcat ggtcgataag       720
     ggctacaagc accgctgggg catcggccgc catttccacg gcagccagat tttcgactac       780
     tggaccgatc ccgccggctt ccacgtcgag cattacgtgg acggtgacct cgtcaacaac       840
     gactcgccga ccctgagtta tccgttcgga cgagacacgt tgctgcaatg gggcccggct       900
     ttcccgggtc tttga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page