(data stored in ACNUC29543 zone)

EMBL: CP001044.PE403

CP001044.PE403       Location/Qualifiers
FT   CDS_pept        complement(466108..466848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3528"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: reu:Reut_A3378
FT                   OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72672"
FT                   /db_xref="GOA:B2JLN9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLN9"
FT                   /protein_id="ACC72672.1"
FT                   /translation="MRNYRKNVRPAVMAGLICSAALAGNANAQSAGSFTLATGWLYVAP
FT                   QGHATPLTVESVGGMPVNQQLTGTGAHASSTNTLGITTEYYVTDNIGIATLFGLPLTVN
FT                   LDGDGTLSKYGTLGTTRPMPPAIEVRYHLFDAQTKFRPYVGLGVNYTWFTQVRATNHQF
FT                   ITDSVGPGGSIHATLSASWNPVFEVGASYMFAKHWSVGASVGYMPLKTHMTIYGQTATG
FT                   TQIVSKSTLRIEPINVFVNVAYTF"
     gtgaggaatt acaggaaaaa tgttcggcct gccgtgatgg caggtcttat ctgttcggct        60
     gcgcttgctg gaaatgcgaa tgcgcaatca gccggaagct ttacgctggc gacggggtgg       120
     ctttacgtag cgccacaggg tcatgcaacg ccgcttaccg tggaaagcgt gggaggtatg       180
     ccggtcaacc agcaattaac ggggactggt gcgcacgcgt cgtcaacgaa tacgctcggc       240
     atcaccaccg agtactacgt gaccgacaac atcggcatcg ccacgctctt tggcctgcca       300
     ctaacagtga atctggatgg cgacgggaca ctctcgaagt acggcacact gggcacgacg       360
     aggcctatgc cgcccgccat cgaggttcga tatcacctgt tcgacgctca gacgaaattt       420
     cgtccttacg tcggattggg cgtgaactac acgtggttca cccaggttcg cgcaaccaac       480
     caccagttca ttaccgatag cgttggtcct ggcggatcga tacacgcgac cctcagtgca       540
     tcgtggaacc ccgtcttcga ggtcggggca agctacatgt tcgccaaaca ctggtcggtc       600
     ggagcgtcgg ttggctacat gccgctcaag acgcacatga ccatatacgg gcagacagca       660
     accggaacgc agatcgtttc gaagtcgacg ctgcgaatcg aacccattaa cgtttttgtg       720
     aacgtcgcct acacattcta g                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page