(data stored in ACNUC29543 zone)

EMBL: CP001044.PE407

CP001044.PE407       Location/Qualifiers
FT   CDS_pept        complement(470460..471530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3532"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bch:Bcen2424_5775
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72676"
FT                   /db_xref="GOA:B2JLP3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP3"
FT                   /protein_id="ACC72676.1"
FT                   /translation="MKLTSAQPARHPHPTAKACALAYLIFERPDLEQAERFLNDFGLQT
FT                   VSRGEGLLLLRGTGASHFCYVVRKASKAAFVGFGLQVATRSELEALATLPGASEVEQSA
FT                   LTGGGYVVRLTDPSGFRVDAIWGQTAASALPHRLPLPFNSVDATVRINDTQRPPTHAPE
FT                   VIRLGHVVLELADYQATCAWYTRHFGFIPSDVQVLPDGSPAVAFMRLDLDDTPADHHTL
FT                   ALAQGFVATYSHSAYELVDADAVGMGQRVLRENGWNHAWGIGRHILGSQIFDYWQDPWG
FT                   DKHEHYCDGDLFTSDEPTGIHAVSREAMAQWGPTMPRSFTKPRLTPASLVALFKNLRRS
FT                   PDLTLNKLRTLAKLFA"
     atgaaactga cttctgcaca gccggcccgt catccgcatc caacggcgaa agcatgcgcg        60
     ctggcctatc tgatcttcga gcggcctgac ctcgagcaag ccgaacgatt cctcaatgac       120
     tttgggcttc aaacagtatc gcggggggaa gggctactgc tgctacgtgg tacaggcgcc       180
     tcgcattttt gctacgtcgt gcgcaaggcg tcgaaagcgg cgttcgtcgg cttcggtttg       240
     caggtcgcga ccaggagtga actcgaagcg ctcgctacgc tgcccggtgc ttcagaggtc       300
     gaacagtctg cgttgacggg tggaggctac gtggtgcgac tgactgaccc ttccggtttt       360
     cgtgtcgatg cgatctgggg ccagacggcc gcatcggcgt tgccgcaccg gctgccgttg       420
     ccgttcaatt ccgtcgatgc cactgtgaga atcaacgaca cgcagcggcc gccaacgcac       480
     gcgccggaag tcatccggct cgggcacgtc gtgctcgaac tcgccgacta tcaggcaacc       540
     tgtgcgtggt acacgcgaca tttcggtttt atcccgagcg acgtgcaggt actgcccgac       600
     ggctcgccgg ctgtcgcgtt catgcgtctc gatctcgacg acacgccggc ggaccatcac       660
     acgctcgcac tggcacaggg atttgtcgcg acgtacagcc acagcgccta cgaactcgtt       720
     gatgcggacg cggtcggtat gggccagcgc gtgctgcgcg agaacggatg gaaccacgcg       780
     tggggcatcg gccggcacat cctgggcagc cagatcttcg attactggca ggacccgtgg       840
     ggcgacaagc acgaacacta ctgcgacggc gacctgttca cgtccgacga gccgacgggc       900
     atccatgccg tgagtcgtga ggccatggcc cagtgggggc cgaccatgcc gcgcagtttt       960
     accaagccga ggcttacgcc cgcgagcctc gtggcgctct tcaagaatct gcgtcgcagc      1020
     cccgacctca cgttgaacaa gctgcgcacg ctggcgaagc tcttcgcctg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page