(data stored in ACNUC29543 zone)

EMBL: CP001044.PE408

CP001044.PE408       Location/Qualifiers
FT   CDS_pept        471994..472707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3533"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bch:Bcen2424_5773 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72677"
FT                   /db_xref="GOA:B2JLP4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP4"
FT                   /protein_id="ACC72677.1"
FT                   /translation="MAAPVTPAPVAEEREPRGARRKRETRARLLDAALRLMAEKGMEGV
FT                   AINEITEAADVGFGSFYNHFESKEAIYTTLVDNVFEEFADMLDRLASGIADPAEVISVS
FT                   VRHTVLRARRDPVWGRFLIREGFSAQMISRGLGQRLLRDIGNGIAAKRFVVADPFIGFL
FT                   AVGGTVLSAIAAELNFVAPGAPAAGVLEEYGFSGEHFPERTAAMLLQTLGLKRAEAEKV
FT                   AARPLPVVEEAAEER"
     gtggcggcgc ccgtcactcc ggcgcccgtt gctgaagagc gggagccgcg cggtgcgcgc        60
     cgcaagcgtg agacgcgtgc ccggctgctc gacgccgccc tcaggctgat ggcagaaaag       120
     ggcatggagg gcgtggcgat caatgaaatc accgaggccg ccgacgtagg gtttggctcc       180
     ttctataacc acttcgaatc gaaggaagcg atctacacga cgctcgtcga caatgtattc       240
     gaggaattcg cggacatgct ggatcgcctc gcgagcggca ttgcggaccc tgctgaggtg       300
     atctccgtct cggtgcgcca cacggtcctg cgtgcgcgac gtgatcccgt gtgggggcgt       360
     ttcctgatcc gtgaagggtt ttccgcgcag atgatcagtc gcgggctggg acagcggctg       420
     ctacgggaca tcggcaatgg cattgccgcg aagcggttcg tcgtcgcgga cccgttcatc       480
     ggattcctcg ccgttggcgg cactgtgctc tcggccattg cggccgagct gaacttcgtc       540
     gcgcctggcg cgccggctgc tggtgttctc gaggaatacg gcttcagtgg agaacatttc       600
     cccgaacgca cggcagccat gctgctgcag acactgggac ttaagcgcgc ggaagcggaa       660
     aaggtcgccg cgcgtccgct gcccgtcgtc gaggaagccg ccgaagaacg ttga             714
//

If you have problems or comments...

PBIL Back to PBIL home page