(data stored in ACNUC29543 zone)

EMBL: CP001044.PE409

CP001044.PE409       Location/Qualifiers
FT   CDS_pept        complement(473097..473858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3534"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   bxe:Bxe_A2126 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72678"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLP5"
FT                   /protein_id="ACC72678.1"
FT                   /translation="MMLMQFRSMRRVARALMGVGLATLAACASPPTRFYTLGIDAQPTI
FT                   AVSTASPSFRIDVRPVKVPAAVARSQLVVQINAAQVQVLEDDRWVSSLPDEIRAALIAG
FT                   VSQQAGAPAAKTLVPGEDVPVYEVTVDIQRFESWPGSHVLVDGVWTVSRSTSADTLTCH
FT                   SVVSEPVSGGYQAVAGGHRRAMSVVAAQIAKAIRAFPASGGDSPSRPDGASGTAGKRGE
FT                   RGERGKRALSCPHATDSVQTAADRTAPRVDE"
     atgatgctga tgcaattccg ctcgatgcgc agggtggcgc gcgcgctcat gggcgtgggc        60
     ctggcaaccc tggcggcatg cgcgtccccg ccgacgcgct tctacacgct cgggatcgat       120
     gcgcagccga cgattgccgt cagtaccgcg agtccatcgt ttcgcatcga cgtgcggccg       180
     gtcaaggtgc cggccgccgt cgcacgaagc cagctggtgg ttcagatcaa tgcggcgcag       240
     gtgcaggtac tggaggacga tcggtgggtg tcgtccctgc ccgacgaaat tcgcgctgcg       300
     ctgattgccg gcgtgagcca gcaggccggc gcgcccgccg cgaagacgct cgttcccggt       360
     gaggacgttc ctgtctatga ggttaccgtc gatattcagc gctttgaatc gtggcctggt       420
     tcgcatgtgc tggttgacgg cgtctggacg gtgagccggt cgactagcgc cgatacattg       480
     acatgccaca gtgtggtgag cgagcccgtg tccggcggct atcaggcggt ggctggcggc       540
     catcgccgcg cgatgagcgt ggtcgctgca cagatagcca aagccatacg tgccttccct       600
     gcaagcggtg gggatagtcc gtcgaggcct gacggggcct cgggcacggc cgggaaaagg       660
     ggggaaaggg gcgaaagagg gaagagggcg ctctcctgcc cgcatgctac cgacagcgta       720
     cagacagccg ccgacagaac ggcgccgcgc gtcgacgaat ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page