(data stored in ACNUC29543 zone)

EMBL: CP001044.PE41

CP001044.PE41        Location/Qualifiers
FT   CDS_pept        complement(37618..38823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3142"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="KEGG: bxe:Bxe_B1246 precorrin-6Y
FT                   C5,15-methyltransferase(decarboxylating); TIGRFAM:
FT                   precorrin-6y C5,15-methyltransferase (decarboxylating),
FT                   CbiE subunit; precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3142"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72310"
FT                   /db_xref="GOA:B2JRI3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B2JRI3"
FT                   /protein_id="ACC72310.1"
FT                   /translation="MPAWLTVVGMGDDGFAGLGKAARRALIDASVIYGGERHLSMLPAC
FT                   LNAVREPWPQPFDIAPVLARRNTPVCVLASGDPMFYGVGATLARQVPADELRVLPAPSS
FT                   VSLAAARLGWALQDVPTVSLVGRPLAALQTHLHEDARVFVLSADGTTPAAVAAWLGERG
FT                   FGATRMIVMEHLGSEAERAIDARAHEWSIGETAALNLIALECRRAAPDAPRLPLTPGLP
FT                   DNAFRHDGQLTKRDVRALTLGRLAPAPGELLWDVGAGCGSIGIEWMRSHASCRAIAIEA
FT                   NGERQGFIEHNRDALGVPGLQLIAGKAPAALQDLPAPDAIFIGGGVTVEGVLDTCWRAL
FT                   KSGGRLVANAVTLEGEAALIAWRAQHGGTLTRIALAEAQPLGGFETWRSGLPVTLLDTR
FT                   KP"
     atgccggcct ggctgaccgt ggtgggaatg ggcgacgacg ggtttgccgg tctggggaaa        60
     gcggcgcggc gcgcgctgat cgacgcatcg gtgatctatg gcggcgagcg gcatctgtcg       120
     atgctgcccg cctgtttgaa cgccgtgcgc gagccgtggc cgcagccgtt cgacatcgcg       180
     cccgtgctcg cgcggcggaa cacgcccgtg tgcgtgctgg cgagcggcga cccgatgttt       240
     tatggcgtcg gcgcgacgct cgcgcgccag gttcccgccg atgaacttcg cgtgctgcca       300
     gcaccgtcgt ccgtgtcgct ggccgcggcg cggctgggct gggcgttgca ggacgtgccg       360
     acggtgtcgc tcgtcggacg gccgctcgcg gccttgcaga cgcatctgca cgaagatgcg       420
     cgcgtgttcg tgctgagcgc ggacggtacg acgcccgcgg ctgtcgctgc atggctcggg       480
     gaacgcggct tcggcgcgac gcgcatgatc gtgatggagc atctgggcag cgaggccgag       540
     cgcgcgatcg acgcccgcgc gcatgaatgg tcgattggcg agacggcggc gctgaatctg       600
     attgcgctcg aatgccggcg cgctgcgccc gatgcaccgc gcctgccgtt gaccccggga       660
     ctgcccgaca acgcgttccg acacgacggt cagctgacga agcgcgacgt gcgcgcgctg       720
     acgctcggcc gtcttgcgcc cgcgcccggc gagttgctgt gggacgtggg cgcgggctgc       780
     ggttcgatcg gcatcgagtg gatgcgatcg cacgcgagct gccgcgcgat tgcgattgaa       840
     gcgaacggcg agcgccaggg tttcatcgag cacaatcgcg acgcgctcgg cgtgccggga       900
     ctgcagctga tcgcgggtaa ggcgcccgcc gcgttgcagg atttgccggc gccggatgcg       960
     attttcatcg gcggcggcgt caccgtggaa ggcgtgctcg atacctgttg gcgcgcgcta      1020
     aaaagcggcg gcaggctggt ggcaaatgcc gtgacgctcg aaggcgaagc ggcgctgatc      1080
     gcatggcgcg cgcagcatgg cggcacgctg acgcgtatcg cgctcgccga agcccagccg      1140
     ctcggcggct ttgaaacgtg gcgttccggg ttgccggtta cgctgctcga cacccgcaaa      1200
     ccgtga                                                                 1206
//

If you have problems or comments...

PBIL Back to PBIL home page