(data stored in ACNUC29543 zone)

EMBL: CP001044.PE413

CP001044.PE413       Location/Qualifiers
FT   CDS_pept        complement(478448..481621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3538"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bxe:Bxe_A1967 multidrug efflux pump, RND family,
FT                   AcrB/AcrD/AcrF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72682"
FT                   /db_xref="GOA:B2JLZ2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ2"
FT                   /protein_id="ACC72682.1"
FT                   /translation="MNARDHENAGDGALVNTPEKPADDGTGFNLSAWALRHQQLVIFLI
FT                   GLMTLFGVIGYTHLAQSEDPPFTFRTMVIKTYWPGATAREVQEQITDRIGRQLQAAPYV
FT                   DNIKSYSRPGESMIFFAMKDSAPVREVPETWYQVRKKVGDIRATLPKGAVGPFFNDEFG
FT                   DVYTNIYALEGDGYTPAQLHDYADKLRTVLLRVPGVAKVDYFGDPDQHIFVEISNTQLT
FT                   RLSITPQQLAQAIDAQNAVAPVGTITTADDRVFVRPSGAFRDEQALADMLVTVNRRTFR
FT                   LGDIATIKRGYDDPPVTQMRVGGQAVLGIGVTMQKGGDVIDLGKALDARTAELQASLPA
FT                   GLKLAAVASMPHAVKHSVDDFVEAVGEAVAIVLVVSLVSLGLRTGMVVVITIPIVLAVT
FT                   ALCMHLFGIGLDKVSLGTLVLALGLLVDDAIIAVEMMAVKLEQGWSRMRAAAFAYTSTA
FT                   FPMLTGTLVTVSGFLPIALAKSSTGEYTRSIFEVSAISLVVSWFAAVVLVPLLGFHLLP
FT                   ERAGPASGGHGHEHDVYDTGFYKRLSGWVAACIHRRWVVLGITAVLFVIAMGAFTRVPQ
FT                   QFFPNSERPELLVDLRLPEGASFEATLRESKRLEKVLEGKPGIDHFVDFVGTGAPRFYL
FT                   PLDQQLQQPNFAQFVITAKDVETREELMHWLDAKLEKDFSGVRTRVARLENGPPVGFPI
FT                   KFRVSGDDVATVRSIAETVADKTRADSRTRNVQFDWDEPAERSISFEIDQNRARQLGVT
FT                   SEDVSSFLAMTLSGYTVTQYRERDKLINVDLRAPNSERVDPAKLTSLAIPTPNGPVPLG
FT                   SLGHVRDTLEYGVIWERDRQPTITVQADVRGDAQGIDVTHDIDHALATVRAKLPVGYRI
FT                   DVGGAVEESVKGQTSINAEMPLMIIAVLTLLMIQLKNFARTFIVVLTAPLGLIGVVAAL
FT                   LLFGKPFGFVALLGVIAMFGIIMRNSVILVDQIDQDIAAGHARFDAIIGATVRRFRPIM
FT                   LTAAAAVLALIPLLRSGFFGPMATALMGGITIATMLTVFFLPALYATCFRVRRDERGTQ
FT                   QVVVEHTEV"
     atgaacgccc gcgaccatga aaacgcgggg gacggcgcgc tcgtgaatac tcccgaaaag        60
     ccggccgatg acggaaccgg tttcaatctc tctgcctggg cgctgcggca ccagcagctt       120
     gtgatctttc tgatcgggct gatgacactc ttcggcgtga tcggctatac acacctggcg       180
     cagtcggaag atccgccgtt caccttccgg acgatggtca tcaagacgta ctggccgggc       240
     gcaaccgccc gggaagtgca ggagcagatc acggaccgga tcggccgcca gttgcaggcg       300
     gcgccctatg tggacaacat caagagctac tcgcgccccg gcgagtcgat gatcttcttc       360
     gcgatgaagg actccgcgcc cgtgcgcgag gtgcccgaaa cctggtacca ggtgcgcaag       420
     aaggtgggcg acatccgggc aacgctgccg aaaggcgccg tggggccatt cttcaacgac       480
     gaattcggcg acgtttacac gaacatctac gcgctcgaag gcgacggcta tacgcccgcg       540
     caactgcacg actatgcgga caagctgcgc acggtcctgt tgcgcgtgcc tggcgtggcg       600
     aaggttgact acttcggcga tcctgaccag cacatctttg tcgagatttc gaatacgcag       660
     ctgacgcgcc tgtccattac gccgcagcag ctcgcgcagg ccatcgacgc gcagaatgcc       720
     gtcgcgcccg tcggcaccat cacgacggcg gacgaccgcg tgttcgtgcg gcccagcggc       780
     gcgttcaggg acgaacaggc gctcgcggac atgctggtca ccgtcaaccg gcgtacgttc       840
     cgcctcggcg acatcgcgac gatcaaacgc ggctatgacg atccgcccgt cacccagatg       900
     cgcgtgggcg gccaggcggt gctcggcatt ggcgtgacga tgcaaaaggg cggtgacgtc       960
     atcgatctcg gcaaggcgct cgatgcaagg acggctgaac tgcaggcaag cctgccggcc      1020
     ggtctcaagc tcgctgccgt cgccagcatg ccgcacgcgg tgaagcattc cgtagacgac      1080
     tttgtcgagg ctgttggcga ggcagtggcg atcgtgctcg ttgtcagcct cgtttcgctc      1140
     ggcctgcgca cgggcatggt cgtcgtcatc acgattccga ttgtgctggc cgtgacggcg      1200
     ctgtgcatgc atctgttcgg catcgggctg gacaaggtgt cgcttggcac gctcgtgctc      1260
     gcgctcgggc tgctggtcga cgacgcgatc atcgccgtcg aaatgatggc cgtgaagctc      1320
     gagcagggct ggagccgcat gcgcgcggcg gcctttgcct acacgagcac ggcattcccg      1380
     atgctgacgg gcacgctcgt cacggtctcc ggcttcctgc cgatcgcgct cgcgaaatcg      1440
     agcacgggtg agtacacacg ttcgatcttc gaagtgtcgg ccatttcgct cgtcgtctca      1500
     tggttcgccg ccgtcgtgct ggtgccgttg ctgggctttc atctgcttcc cgagcgcgcg      1560
     ggccctgcga gtggcggcca cggccatgaa cacgatgtct acgacacggg cttctacaag      1620
     cgcctgtcgg gctgggtcgc cgcgtgtatc caccggcgct gggtcgtgct cgggatcacc      1680
     gccgtgctct tcgtcatcgc gatgggcgcc ttcacgcggg tgccgcagca gttctttccg      1740
     aactccgagc ggccggaact gctcgtcgac ctcaggctgc cggaaggcgc ttcgttcgag      1800
     gcgacgctgc gtgaatcgaa gcgcctcgag aaggtcctcg agggcaagcc cgggatcgac      1860
     cacttcgtcg acttcgtcgg cacgggcgcg ccgcgcttct atctcccgct cgaccagcag      1920
     cttcagcaac ccaatttcgc gcagttcgtg atcacggcca aggacgtgga gactcgcgag      1980
     gaactgatgc actggctcga cgcgaaactc gaaaaggact tctctggcgt gcgcacacgc      2040
     gtcgcgcgac tcgaaaacgg cccgcccgtc ggctttccta tcaaatttcg cgtgagcggc      2100
     gacgatgtcg cgacggtgcg ctcgatcgcg gagacggtcg ccgataagac ccgcgccgac      2160
     tcgcgcacgc gcaacgtcca gttcgactgg gacgagccgg ccgaacgctc catctcgttc      2220
     gagatcgacc agaacagggc gcgccagctt ggcgttacat cggaggacgt atccagcttt      2280
     ctcgcgatga cgctctccgg ttacacggtc acgcagtacc gcgagcgcga caagctgatc      2340
     aacgtcgatc tgcgtgcacc gaacagcgag cgcgtcgatc ctgcgaagct cacgagcctg      2400
     gcgattccga cacccaatgg cccggttccg ctcggctcgc tcggacatgt gcgcgatacg      2460
     ctcgaatacg gcgtgatctg ggagcgcgat cgccagccga ccatcaccgt gcaggccgac      2520
     gtgcgtggtg acgcgcaggg catcgacgtg acgcacgata tcgatcacgc gctcgccacc      2580
     gtgcgcgcaa agctgcccgt cggttaccgg atcgacgtgg gcggcgccgt ggaagagagc      2640
     gtcaagggcc agacgtcgat caacgcggaa atgccgctga tgatcatcgc ggtgctgacg      2700
     ctgctgatga tccagctgaa gaacttcgcg cgcacgttca tcgtcgtgct gactgcgccg      2760
     cttggactca tcggcgtagt ggctgcgctg ctgctgttcg gcaagccgtt tggcttcgtg      2820
     gcgttgcttg gtgtgatcgc gatgttcggc atcatcatgc gcaactccgt gattctggtc      2880
     gatcagatcg atcaggacat cgcagcgggt cacgcgcgct tcgacgcgat catcggcgca      2940
     acggtgcggc gcttcaggcc gatcatgctg acggccgccg ccgccgtgct cgcactgatc      3000
     ccgctgcttc gctcgggctt cttcggaccg atggcgacgg cgctgatggg cggcatcacc      3060
     atcgcgacga tgctgacggt tttcttcctg ccagcgctct acgcaacctg cttcagggtg      3120
     cgtcgcgatg agcgcggcac gcaacaggtc gtcgtcgagc atacggaggt ttga            3174
//

If you have problems or comments...

PBIL Back to PBIL home page