(data stored in ACNUC29543 zone)

EMBL: CP001044.PE415

CP001044.PE415       Location/Qualifiers
FT   CDS_pept        483026..483778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3540"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bch:Bcen2424_5773 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72684"
FT                   /db_xref="GOA:B2JLZ4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ4"
FT                   /protein_id="ACC72684.1"
FT                   /translation="MPDGRHLRAGRRQTAKPSCTNREPMPGRSPRVARRRHETRSRLLD
FT                   AAFGLVVENGMDGVTISQITDAADVGFGSFYSHFDSKEGIFAALVEWLFEEFANTLDRL
FT                   ASGLTDPAEVIAVSVRHTLLRAYREPVWGQLLIREGLSARALSRGLGQRLLRDTARGIA
FT                   EKRFQVADELMSVISVIGTVLAAIAAELDLSTPPRRTSRIRKILPSRAEKFAGSTAAIV
FT                   LQAFGLARPEAEKIARRPLPAALQDTTA"
     atgccagatg gccgtcatct gcgcgcaggt cgcaggcaaa cagccaaacc gtcatgcacg        60
     aaccgcgagc ccatgccagg gcgctcgccc cgtgtggccc gacgcaggca cgagacgcgc       120
     tcccgcctgc tcgatgccgc attcgggctg gtcgtggaaa atggaatgga cggcgtcacg       180
     atcagtcaga ttacggacgc agcggacgtg ggattcgggt ccttctatag ccacttcgac       240
     tccaaggaag gcatcttcgc tgcgctggtc gagtggctct tcgaggaatt cgctaacacg       300
     cttgaccgac tcgccagcgg attgaccgac ccggcggaag tcatcgcagt ttctgtgcgc       360
     catacgcttt tgcgcgccta ccgcgaaccg gtatggggac aactgctgat acgcgaagga       420
     ttgtccgcgc gtgcgctcag cagaggactg ggtcagcggc tgctgcgaga cacggcacga       480
     ggcattgcag agaagcgctt tcaggtcgca gatgaactga tgtccgtgat ttcggtgatt       540
     ggcaccgtgc tggcggcaat cgctgcggaa ctcgatctct cgacgccgcc caggcggacc       600
     tcgcgcatcc gcaagattct cccgtcgagg gccgagaaat tcgccgggag taccgcggcc       660
     atcgtcttgc aggcgtttgg tctcgcacga ccggaagccg agaagatcgc ccgccgtccg       720
     ctgccggcag cgctgcagga tacaaccgcc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page