(data stored in ACNUC29543 zone)

EMBL: CP001044.PE416

CP001044.PE416       Location/Qualifiers
FT   CDS_pept        complement(486352..486849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3544"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: pde:Pden_4517
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72685"
FT                   /db_xref="GOA:B2JLZ5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ5"
FT                   /protein_id="ACC72685.1"
FT                   /translation="MCDLQAISAVALNHFFAQRAMRAFWTHFDETLRHTDVNASQFCML
FT                   ALLHQREPLVFGDMAAELEMDRSNLSANLAPLLRRGLISTITHERDRRKRQLVVTARGR
FT                   KAVTSAMIPWMRAYQDTFTFVRLLDIDSMRDLFRVMRDMKKQDDLSGTAVRPESQLVLR
FT                   ND"
     atgtgtgatc tgcaagcaat ctccgcagtc gcactgaacc atttttttgc ccagcgcgcg        60
     atgcgggctt tctggaccca tttcgacgaa acgctgcgac ataccgatgt caacgcctcc       120
     cagttttgta tgctcgcctt gctgcatcaa cgcgagccac tggttttcgg cgatatggct       180
     gcggaactcg aaatggaccg gtcgaatctg tcggccaatc tggcaccact gctccgccgc       240
     gggcttatct caacgatcac ccacgaaaga gatcgacgga aacgtcagct tgtcgtgact       300
     gcgcgaggtc gaaaagctgt gacttccgca atgatcccct ggatgcgggc ctaccaggat       360
     accttcacgt ttgtgaggct gcttgatatc gattccatgc gcgatctctt tcgtgtgatg       420
     cgggacatga aaaagcagga tgacctgagc ggaaccgcgg ttcgcccaga atctcagttg       480
     gttttacgaa acgactag                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page