(data stored in ACNUC29543 zone)

EMBL: CP001044.PE418

CP001044.PE418       Location/Qualifiers
FT   CDS_pept        complement(491019..492134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3547"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bam:Bamb_6578 efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72687"
FT                   /db_xref="GOA:B2JLZ7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ7"
FT                   /protein_id="ACC72687.1"
FT                   /translation="MFSRRLATSALACALPFALAACGEKTLSDPRIEAPLVRMSVVQRA
FT                   VPASRSFTGTIAARVQSDLGFRVSGKVLERLVDAGQTVKRGQPLMRLDPVDLKLAAQAR
FT                   QEAVAAARARAQQTAQDEERYRDLRGTGAISASAYDQAKAAADAASAQLNAAEADADVA
FT                   RNATGYAGLVADGDGVVMETLAEPGQVVSAGQPVVRLAHAGHREAVIQLPETLRPAIGS
FT                   VAQATLFGNSGLSVPATLRQLSDTADSHTRTFEARYVLQGALADAPLGATVTIEIPDAR
FT                   VALQDGLQVPIGAVLDAGKGPGVWVINGEPAKVAWRPVTVLHLDDDSARVSGTLKQGER
FT                   VVALGAQLLREGEPVRVSGQAVAMASEGARP"
     atgttctcgc gtcgcctcgc cacttccgca ctcgcctgtg cgctgccgtt tgcgctagcg        60
     gcctgcggcg aaaaaacact gtccgatccg cgcatcgaag ccccactggt gcgcatgtcc       120
     gtcgttcaac gcgccgtccc cgcgtcccgt tcgtttacag ggaccatcgc ggcgcgcgtg       180
     cagagcgacc tcggtttccg tgtttcgggc aaggtgctgg aacggctggt ggatgccggt       240
     caaaccgtca agcgcggtca gccgcttatg cgcctcgacc ccgtcgatct caagcttgcc       300
     gcgcaggccc gacaggaggc ggtcgccgcc gcgcgggcgc gagcgcagca gaccgcgcag       360
     gacgaggagc gctaccgtga cctgcgcggc acgggtgcca tctcggcttc ggcctacgac       420
     caggccaagg cggccgccga tgcggccagt gcgcagctca atgcggccga ggctgacgcc       480
     gacgtggcgc gcaatgcgac gggctatgcc gggttggtgg cggacggcga tggcgttgtg       540
     atggaaacgc tggccgaacc cggtcaggtc gtcagcgccg gacagcctgt ggtacgcctc       600
     gctcacgccg gccatcgcga ggctgtgatc cagctaccgg aaaccctgcg ccccgccatc       660
     ggttcggtcg cccaggccac gctgttcggc aacagcggcc ttagcgtgcc agccacgctg       720
     cgccagctct cggatacggc ggattcgcat acccgcacct tcgaagcgcg ctatgtgctg       780
     cagggcgcgc tggccgacgc gccgctaggc gcaaccgtca cgatcgagat accggacgca       840
     cgcgtggcgc tccaagacgg tttgcaggtg ccgattggcg cggtgctcga cgcgggcaag       900
     ggcccgggcg tgtgggtgat aaacggcgag ccggccaagg ttgcgtggcg gccggtgacg       960
     gtccttcacc tggacgacga cagcgctcgc gtgtcaggta cgttgaagca aggcgagcgg      1020
     gtcgtcgcgc tcggcgccca gttgctacgc gaaggtgagc cggtccgcgt gtccggccag      1080
     gccgtcgcga tggcgagcga aggagcacgt ccgtga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page