(data stored in ACNUC29543 zone)

EMBL: CP001044.PE419

CP001044.PE419       Location/Qualifiers
FT   CDS_pept        complement(492217..492840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3548"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bam:Bamb_6577
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72688"
FT                   /db_xref="GOA:B2JLZ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041478"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ8"
FT                   /protein_id="ACC72688.1"
FT                   /translation="MPMKNTTIPSAPARGPADHEVRDQIVAAATEHFSRYGYDKTTVSD
FT                   LAKAIGFSKAYIYKFFESKQAIGEMICGNCLHEIESEVRAAVADTDLPPEKLRRMFKVF
FT                   TDASLRLFFRDRKLYDIAASAATENWQAVQAYEARVQKLLQEVLQEGRQSGDFERKTPL
FT                   DETATAIYLVLRPYLNPLLLQYNRDTTDVAPAQLSSLVLRSLSP"
     atgcccatga aaaacaccac cattccctct gcccccgcgc gcggcccggc cgatcacgag        60
     gtgcgggacc agatcgttgc cgcggccacc gagcacttca gccggtatgg ctacgataaa       120
     accacggtct cggacctcgc caaggcgatc gggttttcca aggcctacat ctacaagttc       180
     ttcgaatcca agcaggccat tggcgagatg atctgcggca actgcctgca cgagatcgaa       240
     agcgaggtca gggcggccgt agcggacacc gatctgccgc cggagaagct gcggcggatg       300
     ttcaaggtct ttaccgatgc gagcctccgt ctgtttttcc gggaccgcaa gctttacgac       360
     atcgccgcat cggctgccac cgaaaactgg caggccgtgc aagcttatga agcacgtgtt       420
     cagaaactgc tgcaggaggt tttgcaggaa ggtcggcaaa gcggtgactt cgagcgcaag       480
     acgccactgg acgaaaccgc gacggcgatc tatctggtgc tgcgccccta cctcaacccg       540
     ctgctgcttc agtacaaccg cgataccacc gatgtcgcgc cggcgcagtt gtccagccta       600
     gtacttcgta gcctgtcgcc ctaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page