(data stored in ACNUC29543 zone)

EMBL: CP001044.PE420

CP001044.PE420       Location/Qualifiers
FT   CDS_pept        492911..494371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3549"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: bam:Bamb_6576 RND efflux system, outer
FT                   membrane lipoprotein, NodT family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72689"
FT                   /db_xref="GOA:B2JLZ9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:B2JLZ9"
FT                   /protein_id="ACC72689.1"
FT                   /translation="MLPRHLLAAVIVTSLSTGCAVGPDYVRPAVAMPDSFQGQAAVDHR
FT                   QAAASADLATWWTGFGDPQLTRFVTLALEQNLDLAQAAARVSQARAGLGAANAALLPSG
FT                   NVNGQAARVYQSVETPLGRVLNSTPGFDRYGNDYEANFSASWELDVFGGLRRGREAALA
FT                   DYQASEAGEVATRLAVAAQTADIYITIRGLQARLQVARKQLQTQQDLLSTIKLLYGKGL
FT                   AADLQVSQAEGALAQVQASIPVLEAGLDAAMNALDVMLGSQPGTHRAELLEGGDIPTAP
FT                   QIAGTGSPGTLLRRRPDLIVAERRLAASNARIGVAIAEYYPKVSLSGLIGSATSVASDN
FT                   LFSSGASQGAGVLGLRWRLFDFGRINAQIKEAKGQEAEMLAAYRLAALHATEDVENSYS
FT                   ALVKREDQAAILAQGVSSLGRARAASFAAYQKGVVSLIEVLQADDNLLRASDGRVQAQT
FT                   ESARAAIAAFKALGGGWQPTGPEAVVSR"
     atgctaccca gacacctcct tgccgcagtc attgtcacca gcctctcgac aggctgcgcg        60
     gttggtcccg actatgtgcg accggctgtc gccatgccag acagcttcca gggccaagcc       120
     gcagtcgatc accggcaggc ggcggccagc gccgaccttg ccacgtggtg gacgggtttc       180
     ggcgatccgc agctgacgcg gttcgtcacg ctcgcgctgg aacagaacct ggacctcgcg       240
     caggccgccg cgcgcgtctc gcaggcgcgc gcaggactcg gcgcggcgaa cgccgcgctg       300
     ctgccgtccg gcaatgtcaa cggccaggct gcgcgggttt accagtcggt tgagactccc       360
     ttggggcggg tcctcaattc gacgcccggt ttcgaccgct acggcaacga ctatgaggcc       420
     aatttcagcg cgagctggga gctggatgtg ttcggtggcc tgcgtcgcgg acgggaagcg       480
     gcgcttgccg actatcaggc ttcagaggcc ggcgaggtgg ccacgcgcct ggctgtggca       540
     gcgcagactg cggacatcta catcactatt cgtggattac aggctcgtct tcaggtggcc       600
     cgcaagcagt tgcagacgca gcaggatcta ctttcgacca tcaagcttct gtacgggaaa       660
     ggcctcgcgg ccgacctgca ggtgagccag gctgaaggcg cgctggctca ggttcaggcg       720
     tccatcccgg tccttgaggc agggctggat gcggcgatga acgcgctgga cgtgatgctg       780
     ggttcacagc ccggcacgca tcgggcggaa ctcctcgagg gcggcgatat cccgaccgct       840
     cctcaaattg cgggcaccgg ctcgccgggt accttgctca ggcgtcggcc cgatctgatc       900
     gtggcggagc ggcgcctcgc tgcatcgaac gcgcgtattg gcgtggccat cgcagagtac       960
     taccccaagg tgtcgctcag tggcttaatc ggcagcgcta cctcggtggc cagcgacaac      1020
     ctgttcagta gcggtgccag tcagggcgcc ggcgtgctgg ggctgcgctg gcgtctgttc      1080
     gatttcggcc gcatcaatgc gcagatcaag gaggccaaag ggcaggaagc cgagatgctc      1140
     gccgcctacc ggcttgccgc attgcatgct acggaggatg tcgagaattc ttactcggca      1200
     ctcgtcaagc gcgaggatca ggctgccatt ctcgcgcagg gtgtgagctc gctcggacgc      1260
     gcgcgggcgg cctcgttcgc cgcttatcag aagggtgtcg tcagcctgat cgaagtgctg      1320
     caggcagacg acaacctctt gcgcgcctcg gatgggcggg tgcaggcgca aacggaatcg      1380
     gcgcgcgcag cgatcgcggc attcaaggcg ctcggtggcg gctggcaacc taccggtcct      1440
     gaggccgttg taagccgata g                                                1461
//

If you have problems or comments...

PBIL Back to PBIL home page