(data stored in ACNUC29543 zone)

EMBL: CP001044.PE423

CP001044.PE423       Location/Qualifiers
FT   CDS_pept        496100..497509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3552"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; KEGG: reu:Reut_C6135 regulatory protein
FT                   GntR, HTH:aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72692"
FT                   /db_xref="GOA:B2JM02"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM02"
FT                   /protein_id="ACC72692.1"
FT                   /translation="MTKLSIGLDRAGRISLSAQIYGSIRDTIESGQLAAGARLPSWSDL
FT                   AAQLGVSRGTVRAAYERLIDEQFAIGLGAAGTRVTARPSPATTGWSPEAPPLPDLFYDF
FT                   NAAPLAFQMGVPSQDAFPFKLWSRIQARAARRAAAAPVGYPDPRGEPDLRQEIAAYLGV
FT                   SRGLRCSPSQVFVTVGFSGALNLAIRALRVEGRQAWMEDPGFPLTRTALELAGMTVAGV
FT                   PVDADGLDIDAGTRIAPKAVLAVVTPGQQAPLGMTMSLARRISLLGWARQHEAWIVEDD
FT                   YLGELQLKGRAAPALASLDQDGRVLHIGTFSKTISPALRLGFLVVPPAMARHFGDVAAC
FT                   LAPAPAASVQHAVTEFMHDGHYLRHLRRMKRLYAARQEALVHCLKEQASESLRVQGAAG
FT                   MTVVAALSQSVSDVEIALRARAFGLAPVPLSPWYTGDPGQQGLLLGVTNLSEKTLPANC
FT                   HRLLELARGRY"
     atgacaaagc tttctatcgg cctcgatcgc gccggacgca tctctctatc agcgcaaatt        60
     tacggctcga ttcgagatac gatcgagtcg ggccagcttg ccgccggcgc gcggctgccc       120
     tcctggtcgg atctggccgc ccagctcggc gtgtcccggg gtaccgtgcg ggccgcctat       180
     gaacgtctga tcgacgagca gttcgcgatc ggccttggcg cggccggaac ccgggtaacc       240
     gcgcggccct cgcccgcgac gaccggatgg tcgcccgagg cgccgccgct gcctgatctg       300
     ttctacgact tcaacgcggc gcctttggcg tttcaaatgg gtgtgccctc ccaggacgcc       360
     tttccgttca agctctggtc acgcattcag gcgcgcgcgg cgcgccgggc ggcagcggct       420
     cctgtaggct accccgatcc acgcggcgaa ccggacttgc gacaggagat cgcggcgtat       480
     cttggtgtct cacgcggact tcgatgcagt ccgtcccagg tcttcgtcac ggtaggtttc       540
     tccggcgcgc tcaatctcgc gattcgtgcc ctgcgcgtgg agggcagaca agcctggatg       600
     gaagaccccg gctttccgct cacgcgtacg gcgcttgagc tggcgggaat gaccgtggca       660
     ggcgtgccgg tggacgcgga tgggctcgat atcgacgcag gcacccggat cgcacccaaa       720
     gcggtcctcg cggtggtgac accgggccag caggccccgc ttgggatgac gatgtctctc       780
     gctcgacgga tatcattact cggctgggcc agacaacacg aagcctggat cgttgaagac       840
     gattacctcg gcgagttgca gctgaaagga cgggccgcac cggcactggc ctcgctcgat       900
     caggatggac gggtgctgca catcgggacc ttcagcaaga cgatcagccc ggcactgcgt       960
     ctgggatttc tcgttgtacc gccggccatg gcacggcact tcggcgacgt cgcggcgtgt      1020
     ctcgcgcccg cccccgctgc atccgtgcag cacgccgtga ccgagttcat gcacgacgga      1080
     cactatcttc gccacctgcg acgtatgaag cgtctctacg ctgcgcggca ggaagctctc      1140
     gttcattgtc tgaaggagca ggcctcggaa tcgctcagag tgcagggcgc cgccggcatg      1200
     accgtcgtgg ccgcgctttc ccaatccgta tcggatgtcg agatcgcttt gcgggcgcga      1260
     gctttcgggc tcgccccagt tcctctctct ccctggtaca caggcgatcc ggggcagcag      1320
     gggctactgc tcggcgtgac gaatctgagt gaaaaaacgc tgccggccaa ctgtcaccgc      1380
     ctgctggaac tcgctcgcgg gcgctactga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page