(data stored in ACNUC29543 zone)

EMBL: CP001044.PE424

CP001044.PE424       Location/Qualifiers
FT   CDS_pept        497629..498072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3553"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   reu:Reut_C6134 cupin region"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72693"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM03"
FT                   /protein_id="ACC72693.1"
FT                   /translation="MNIQSIARAACTAMAFAIAVPAAAHGAAETVTPNFQHAIPNIPGK
FT                   SLTAVVVDYAPGAASSAHRHAGSAFIYAYVVSGEIESQVDEGPKRVYHAGESFFEEPGA
FT                   VHRMSRNASETEPAKLLAMFVADSNDKALTTPSSNPPPYGVTS"
     atgaacattc aatccatcgc aagagccgcc tgcacagcca tggccttcgc catcgccgtg        60
     cccgccgcgg cgcacggtgc ggctgaaacg gtcacaccaa actttcagca cgccattccc       120
     aacattccgg gcaagtcgtt gaccgccgtc gtcgtcgatt acgcaccggg tgccgcgtct       180
     tcagcgcaca ggcatgcggg ctcggccttc atctatgcct atgtcgtatc gggcgagatc       240
     gagtcacagg tcgatgaagg tccgaagcgt gtctaccatg ccggcgaaag cttcttcgag       300
     gagcccggcg ccgttcaccg catgagccgc aacgcgagcg aaaccgagcc tgcaaagcta       360
     ctcgccatgt tcgtcgcgga cagcaacgac aaagcgctga ccaccccatc aagtaatcca       420
     ccaccttacg gagtcacctc atga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page