(data stored in ACNUC29543 zone)

EMBL: CP001044.PE429

CP001044.PE429       Location/Qualifiers
FT   CDS_pept        complement(502917..504929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphy_3559"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: bxe:Bxe_B0963
FT                   putative biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphy_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ACC72698"
FT                   /db_xref="GOA:B2JM08"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B2JM08"
FT                   /protein_id="ACC72698.1"
FT                   /translation="MFNKILIANRGEIACRVAATCKRLGITSVAVYSDADANAKHVAAC
FT                   DEAVHIGGSTAAQSYLRVERIIQAAIATGAQAVHPGYGFLSENEDFAHACEKAGIAFIG
FT                   PPVEAIAAMGSKAAAKALMHSAAVPLVPGYHGDDQSADLLHRQADQIAYPVLLKASAGG
FT                   GGKGMRVVERTEDFAAALASCKREAASSFGNDRVLIEKYLTRPRHVEVQVFADKHGGAV
FT                   YLFDRDCSVQRRHQKVLEEAPAPGLQPHVRRAMGEAAVAAARAVNYVGAGTVEFIMTEG
FT                   GEFYFMEMNTRLQVEHPVTEMVTGLDLVEWQLRVAAGEPLPLAQDQLRVEGHAIEARIY
FT                   AEHPARGFLPSTGTLKHLRMPEGVEFTLGVGGERAPVRIDSGVREGDTITPFYDPMIAK
FT                   LIVHGASREEALKRMSQALRGCEVVGPHTNVEFLQRIVTSVPFSTGDLDTGLIERHHAA
FT                   LFAPVAKPFVEALALACGALLTREGGVAHGASPWDALSHWRLNSGYMQTLNWRDVETES
FT                   AFSVLFSRDGDTQTLTHEGRTEPFKWWTGAGRHEYGATIGDAHVTGRVFIDGDTFHVFC
FT                   RGEALAFEWQNLLAHAADAEHGEGRLTAPMPGKVIAVLVEQGAVVEKGQPLIVMEAMKM
FT                   EHTIGAPAAGKVAELLYGVGDQVADGAQLLVLDVE"
     atgttcaaca agatcctgat tgcgaaccgg ggcgagattg cctgccgcgt ggccgcgacc        60
     tgcaagcggc tcggcatcac gagcgtcgca gtctattccg acgccgacgc gaacgcgaag       120
     cacgtcgcgg catgcgatga agccgtgcac atcggcggat cgacagcggc gcaaagctat       180
     ctgcgcgtcg aacgcatcat ccaggccgcc atcgcgacgg gtgcgcaagc cgtgcatccc       240
     ggttatggct tcctgtcgga gaacgaggat ttcgcgcacg cttgcgagaa agcgggcatc       300
     gcattcatcg gaccgcccgt cgaagcgatc gccgcgatgg gttcgaaggc cgcggcgaaa       360
     gcgctgatgc attcggccgc cgtgccgctc gtgccgggct atcatggcga cgaccagagc       420
     gccgacctgc tgcatcgcca ggccgatcag atcgcttacc ctgtgctgct gaaagcgagc       480
     gcgggcggcg gcggcaaggg catgcgcgtg gtcgagcgca cggaagactt cgcggccgcg       540
     ctcgcgtcgt gcaagcgcga ggcggcgagc agcttcggca atgaccgcgt gctgatcgaa       600
     aagtatctga cacggccgcg tcacgtcgaa gtgcaggtct tcgcggacaa gcacggcggc       660
     gccgtctatc tgttcgaccg cgactgttcg gtgcagcggc gtcaccagaa ggtgctcgag       720
     gaggcgcccg cgcccggcct gcagccgcat gtgcgtcgcg cgatgggcga agcagccgtg       780
     gcggcggcgc gcgcggtgaa ctacgtgggt gcgggcaccg tcgagttcat catgacggaa       840
     ggcggcgagt tctacttcat ggagatgaac acgcgtctgc aggtggagca tcccgtgacg       900
     gagatggtga cggggctcga tctcgtcgaa tggcagttgc gtgtcgcggc gggcgagccg       960
     ttgccgcttg cgcaggacca gttgcgtgtc gaagggcacg cgatcgaagc gcgcatctat      1020
     gccgagcatc cggcgcgcgg cttcctgccg tcgacgggga cgttgaagca tctgcgcatg      1080
     cccgaggggg tcgaattcac cctcggcgtg ggcggcgagc gcgcgcctgt gcgcatcgac      1140
     agcggcgtgc gcgagggcga tacgatcacg ccgttctacg acccgatgat cgccaagctg      1200
     atcgtgcacg gcgcgagccg cgaagaagcg ttgaagcgca tgagccaggc gttgcgcggc      1260
     tgcgaggtgg tcggtccgca tacgaacgtc gagttcctgc agcggatcgt gacgagcgtg      1320
     ccgttttcga cgggcgatct ggacacgggc ttgatcgagc gtcatcacgc cgcgctgttc      1380
     gcgcccgtcg cgaagccgtt cgtcgaagcg ctcgcgctgg catgcggtgc gctgctgacg      1440
     cgcgaaggcg gcgtcgcgca tggcgcatcg ccgtgggacg cgctgtcgca ctggcgtctg      1500
     aacagtggct atatgcagac tctgaactgg cgcgatgtcg aaaccgagtc ggcattttca      1560
     gtgctctttt cgcgcgacgg cgacacgcag acgctgacgc atgagggtcg aaccgagccc      1620
     ttcaagtggt ggacgggcgc tggccggcat gaatacggcg cgaccatcgg cgatgcgcat      1680
     gtgacgggcc gcgtcttcat cgacggcgat acgttccatg tgttctgccg cggcgaagcg      1740
     ctagcgttcg aatggcaaaa cctgctggcg catgcagcgg acgccgagca tggcgaagga      1800
     cgcctcactg cgccgatgcc gggcaaggtg atcgccgtgc tggtcgaaca gggcgccgtc      1860
     gtggagaagg ggcagccgct catcgtgatg gaagcgatga agatggagca cacgatcggc      1920
     gcgcccgcag cgggcaaggt ggcggagttg ctgtacggcg tcggcgatca ggtcgccgac      1980
     ggcgcacagc tgctggtgct cgacgtcgaa taa                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page